Recombinant Human Free fatty acid receptor 1 (FFAR1)

Code CSB-CF008604HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
FFAR1; GPR40; Free fatty acid receptor 1; G-protein coupled receptor 40
Species
Homo sapiens (Human)
Expression Region
1-300
Target Protein Sequence
MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for medium and long chain saturated and unsaturated fatty acids that plays an important role in glucose homeostasis. Fatty acid binding increases glucose-stimulated insulin secretion, and may also enhance the secretion of glucagon-like peptide 1 (GLP-1). May also play a role in bone homeostasis; receptor signaling activates pathways that inhibit osteoclast differentiation. Ligand binding leads to a conformation change that triggers signaling via G-proteins that activate phospholipase C, leading to an increase of the intracellular calcium concentration. Seems to act through a G(q) and G(i)-mediated pathway. Mediates the anti-inflammatory effects of omega-3 polyunsaturated fatty acids (PUFAs) via inhibition of NLRP3 inflammasome activation.
Gene References into Functions
  1. Study reports the 2.76-A crystal structure of human GPR40 complexed with compound 1 bound in a second structurally distinct allosteric site, located at the receptor side facing the membrane lipophilic environment. Binding of compound 1 stabilizes the intracellular loop 2 (ICL2) of GPR40 in a helical conformation. Mutagenesis studies in ICL2 shows that this loop is important for Gs alpha subunit coupling. PMID: 29695780
  2. Data indicate that 20-HETE and FFAR1 function together in a positive feedback loop to enhance glucose-stimulated insulin secretion (GSIS). PMID: 29330456
  3. Comparison with an additional 2.2-A structure of the human GPR40-MK-8666 binary complex reveals an induced-fit conformational coupling between the partial agonist and AgoPAM binding sites, involving rearrangements of the transmembrane helices 4 and 5 (TM4 and TM5) and transition of the intracellular loop 2 (ICL2) into a short helix. PMID: 28581512
  4. Results show that GPR40 negatively regulated the cell motile and invasive activities of HT1080 cells suggesting that GPR40 negatively regulates the tumor progression of fibrosarcoma cells. PMID: 26331585
  5. Brain free long-chain fatty acids-GPR40/FFA1 signaling might have an important role in the modulation of endogenous pain control systems. (review) PMID: 28154332
  6. It regulates insulin secretion in pancreatic beta-cells. (review) PMID: 26028412
  7. Data from molecular docking simulations suggest that the binding pocket of GPR40 exhibits binding of free fatty acids (FFA) with chain lengths of C15 or fewer; for FFA with lengths longer than C15, part of alkyl chain extends out of binding pocket. PMID: 26974599
  8. GPR120 negatively and GPR40 positively regulate cellular functions during tumor progression in lung cancer cells. PMID: 26968637
  9. These data demonstrate that R104 in GPR40 is critically involved in the normal receptor functions. Interestingly, R104P is a registered single-nucleotide polymorphism of GPR40. PMID: 26505901
  10. Characterizing pharmacological ligands to study the long-chain fatty acid receptors GPR40/FFA1 and GPR120/FFA4 PMID: 25131623
  11. results suggest that FFAR1 is the functionally dominant free fatty acid receptor in both human and guinea pig airway smooth muscle. PMID: 26342087
  12. upregulation of GPR40 expression enhances the mitogenic response to epoxyeicosatrienoic acids PMID: 25679385
  13. Palmitic acid boosted inflammatory response of microvascular endothelial cells to LPS via GPR40 and nSMase. PMID: 25795558
  14. knocking down the expression of the regulatory subunit PKAR1alpha, thereby reproducing the effects of IL-1beta and PGE on VSMCs, we demonstrated the contribution of PKA activity to the observed behavior of VSMCs PMID: 26408932
  15. These results suggest that distinct effects of GPR120 and GPR40 are involved in the acquisition of malignant property in pancreatic cancer cells. PMID: 26282200
  16. GPR40 functions via both G protein-mediated and beta-arrestin-mediated mechanisms; endogenous and synthetic ligands differentially engage these pathways to promote insulin secretion. PMID: 26157145
  17. GPR40 and PPARgamma can function as an integrated two-receptor signal transduction pathway, a finding with implications for rational antidiabetic drug development. PMID: 26105050
  18. the activation of GPR40 attenuates cisplatin-induced apoptosis. PMID: 25092426
  19. arrestin-3 and GRK2 play an essential role in the regulation of agonist-mediated GPR40 internalization, but are not involved in the regulation of constitutive GPR40 internalization. PMID: 25038452
  20. In a neuroblastoma cell line, GPR40 was activated by docosahexaenoic acid and selective agonists, yet not by palmitic acid. Its activation provoked the phosphorylation of CREB. PMID: 24550142
  21. the crystal structure of hGPR40 receptor bound to TAK-875 at 2.3 A resolution PMID: 25043059
  22. Potent free fatty acid 1 receptor agonist TUG-469 may be promising candidate for the treatment of type 2 diabetes mellitus. PMID: 23861168
  23. It was concluded that FFAR1 in the pancreatic beta-cell plays a substantial role not only in acute potentiation of insulin secretion by palmitate but also in the negative long-term effects of palmitate on insulin metabolism. PMID: 24035997
  24. FFAR1 agonists support beta-cell function, but variation in FFAR1 influences NEFA effects on insulin secretion and therefore could affect therapeutic efficacy of FFAR1 agonists. PMID: 23378609
  25. A review of the physiological role of GPR40 and potential antidiabetic drugs targeting GPR40. [Review] PMID: 23023155
  26. Propionate-stimulated GPR41 strongly coupled to ERK1/2 activation, while the coupling of linoleic acid-activated GPR40 and acetate-activated GPR43 was weaker. PMID: 22712802
  27. GPR41 gene expression is mediated by internal ribosome entry site (IRES)-dependent translation of bicistronic mRNA encoding GPR40 and GPR41 proteins PMID: 22493486
  28. Phytanic acid and pristanic acid activate the free fatty acid receptor GPR40, a G-protein-coupled receptor which is involved in the Ca2+ signaling of fatty acids. PMID: 21570468
  29. GPR40/FFA1 influences both insulin and glucagon secretion in rat islets, but only insulin secretion in human islets. PMID: 22106100
  30. differences in body composition and lipids associated with common SNPs in the FFAR1 gene PMID: 21552566
  31. Results describe agonist-receptor interactions of GPR40 using molecular dynamics simulations. PMID: 20227312
  32. results show expression of GPR40 in pancreatic islets which are regulated by FFA; finding that T2DM islets have lower GPR40 expression & correlation with insulin secretion raises possibility of involvement of GPR40 in diabetes beta-cell dysfunction PMID: 19758793
  33. Free fatty acids regulate insulin secretion from pancreatic beta cells through GPR40 PMID: 12629551
  34. Results suggest that GPR40 is implicated in the control of breast cancer cell growth by fatty acids and that GPR40 may provide a link between fat and cancer. PMID: 15695516
  35. results suggest that the Arg211His polymorphism in the GPR40 protein gene may contribute to the variation of insulin secretory capacity in Japanese men PMID: 15736105
  36. study provides evidence for GPR40 gene expression in pancreatic beta cells and implicates GPR40 in insulin secretion in humans. PMID: 16525841
  37. GPR40 responded to fatty acids with different on-rates, and could be occupied by endogenous agonists before assay, masking the pharmacology of the receptor PMID: 17200419
  38. cell-specific expression of the GPR40 gene involves a characteristic chromatin organization of the locus and is controlled at the transcriptional level through HR2, a potent beta cell-specific enhancer PMID: 17525159
  39. analysis of residues important for agonist recognition and activation in GPR40 PMID: 17699519
  40. Variation in the FFAR1 gene may contribute to impaired beta cell function in type 2 diabetes PMID: 17987108
  41. This newly identified GPR40 variant results in a loss of function that prevents the beta-cell ability to adequately sense lipids as an insulin secretory stimulus because of impaired intracellular Ca2+ concentration increase. PMID: 18583466
  42. A flow cytometry-based binding assay for FFAR1 is reported. PMID: 18927207
  43. In this review, the mechanism of receptor activation, pharmacology, and the physiological functions of the fatty acid binding receptors GPR40, GPR41, GPR43, and GPR119 are discussed. PMID: 19009545
  44. Two arginine-glutamate ionic locks near the extracellular surface of FFAR1 gate receptor activation. PMID: 19068482
  45. Transfection of GPR40 into mice may provide a novel insulin secretagogue beneficial for the treatment of type 2 diabetes. PMID: 19401434
  46. This paper predicts the 5' structure of the human GP40 gene based on alignments between mouse and human genomic DNA. PMID: 17525159

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in brain and pancreas. Detected in pancreatic beta cells.
Database Links

HGNC: 4498

OMIM: 603820

KEGG: hsa:2864

STRING: 9606.ENSP00000246553

UniGene: Hs.248127

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1