Recombinant Human G-protein coupled receptor 39 (GPR39)

Code CSB-CF009812HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
GPR39; G-protein coupled receptor 39
Species
Homo sapiens (Human)
Expression Region
1-453
Target Protein Sequence
MASPSLPGSDCSQIIDHSHVPEFEVATWIKITLILVYLIIFVMGLLGNSATIRVTQVLQK KGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTSSYTLSCKLHTFLFEACSY ATLLHVLTLSFERYIAICHPFRYKAVSGPCQVKLLIGFVWVTSALVALPLLFAMGTEYPL VNVPSHRGLTCNRSSTRHHEQPETSNMSICTNLSSRWTVFQSSIFGAFVVYLVVLLSVAF MCWNMMQVLMKSQKGSLAGGTRPPQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQ IRRIMAAAKPKHDWTRSYFRAYMILLPFSETFFYLSSVINPLLYTVSSQQFRRVFVQVLC CRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQ SKSQSLSLESLEPNSGAKPANSAAENGFQEHEV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Zn(2+) acts as an agonist. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated mainly through G(q)-alpha and G(12)/G(13) proteins. Involved in regulation of body weight, gastrointestinal mobility, hormone secretion and cell death.
Gene References into Functions
  1. data indicate that Zn(2+) acting via ZnR/GPR39 has a direct role in controlling Cl(-) absorption via upregulation of basolateral KCC1 in the colon. Moreover, colonocytic ZnR/GPR39 and KCC1 reduce water loss during diarrhea and may therefore serve as effective drug targets. PMID: 28093242
  2. G protein-coupled receptor 39 (ZnR/GPR39) was shown to regulate the activity of ion transport mechanisms that are essential for the physiological function of epithelial and neuronal cells [Review]. PMID: 29389900
  3. Data suggest that expression of GPR39 undergoes Rho kinase-dependent desensitization following activation by zinc. PMID: 28619258
  4. This study demonstrated that zinc upregulates PKCzeta by activating GPR39 to enhance the abundance of ZO-1, thereby improving epithelial integrity in S. typhimurium-infected Caco-2 cells. PMID: 28515165
  5. obestatin/GPR39 system in the pathogenesis and/or clinical outcome of human gastric adenocarcinomas and highlight the potential usefulness of GPR39 as a prognostic marker in gastric cancer. PMID: 26716511
  6. Chronic administration of many antidepressants induces GPR39 up-regulation, which suggests that the Zn(2+)-sensing receptor may be considered as a new target for drug development in the field of depression. PMID: 25490458
  7. Taken together, our results provided a novel regulatory mechanism for GPR39-1b in NTRS1 signaling. PMID: 24512471
  8. ZnR/GPR39-dependent expression of tight junctional proteins, thereby leading to formation of a sealed intestinal epithelial barrier. PMID: 24967969
  9. Data suggests alterations (down-regulation) of the GPR39 receptor and involvement of CREB-BDNF pathway, possibly triggered by GPR39, as a new pathomechanism of depression PMID: 24333148
  10. Zn(2+) -dependent activation of ZnR/GPR39 also enhances the expression of the Ca(2+) -binding protein S100A4 that is linked to invasion of prostate cancer cells. PMID: 24264723
  11. GPR39 was present in thyroid autoimmune disease, non-toxic nodular goiter and toxic nodular goiter at band p51(kDa). PMID: 23485550
  12. ZnR/GPR39 is tuned to sense physiologically relevant changes in extracellular pH that regulate ZnR-dependent signaling and ion transport activity PMID: 22879599
  13. GPR39 activation increased the expression of the anti-apoptotic protein clusterin in butyrate-treated cells. GPR39 mediates Zn2+-dependent cell growth. PMID: 22545109
  14. GPR39 plays an important tumorigenic role in the development and progression of esophageal squamous cell carcinoma. PMID: 21352519
  15. extracellular Zn(2+), either applied or released following injury, activates ZnR/GPR39 to promote signaling leading to epithelial repair PMID: 20522546
  16. Data show that Phe-V:13 can serve as an aromatic lock for the proposed active conformation of the Trp-VI:13 rotameric switch, being involved in the global movement of TM-V and TM-VI in 7TM receptor activation. PMID: 19920139
  17. GPR39 is probably not the obestatin receptor PMID: 16959833
  18. could activate GPR39 by high concentrations of Zn(2+), demonstrating cell surface expression of a functional receptor that could elicit a Ca(2+) response. PMID: 17054911
  19. GPR39 functions as a Gq-coupled Zn2+-sensing receptor PMID: 17885920
  20. GPR39 protects from cell death by increasing secretion of pigment epithelium-derived growth factor PMID: 18180304
  21. It is proposed that Zn2+ acts as an agonist for GPR39, not in the classical manner by directly stabilizing an active conformation of the transmembrane domain, but instead by binding to His17 and His19 in the extracellular domain. PMID: 18588883

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in many tissues, including the stomach, intestine and hypothalamus.
Database Links

HGNC: 4496

OMIM: 602886

KEGG: hsa:2863

STRING: 9606.ENSP00000327417

UniGene: Hs.432395

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1