Recombinant Human GRAM domain-containing protein 2(GRAMD2)

Code CSB-CF818231HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8IUY3
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKC GREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFG KDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHL QPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFF PSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPR STGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR
Source in vitro E.coli expression system
Gene Names GRAMD2A
Protein Names Recommended name: GRAM domain-containing protein 2
Expression Region 1-354
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

HGNC: 27287

KEGG: hsa:196996

UniGene: Hs.596332

Related Products

GRAMD2A Proteins

GRAMD2A Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.