Recombinant Human GTPase IMAP family member 2(GIMAP2)

Code CSB-CF883377HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9UG22
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKT CSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTS QDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRIC AFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFK QSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCC LLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL
Source in vitro E.coli expression system
Gene Names GIMAP2
Protein Names Recommended name: GTPase IMAP family member 2 Alternative name(s): Immunity-associated protein 2 Short name= hIMAP2
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The heterodimer formed by GIMAP2 and GIMAP7 has GTPase activity. In contrast, GIMAP2 has no GTPase activity by itself.
Subcellular Location Membrane, Multi-pass membrane protein, Cytoplasm, Lipid droplet
Protein Families TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, IAN subfamily
Tissue Specificity Detected in T-cells.
Database Links

HGNC: 21789

OMIM: 608085

KEGG: hsa:26157

STRING: 9606.ENSP00000223293

UniGene: Hs.647071

Related Products

GIMAP2 Antibodies

GIMAP2 Antibodies for Homo sapiens (Human)

GIMAP2 Proteins

GIMAP2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.