Recombinant Human Ganglioside-induced differentiation-associated protein 1 (GDAP1)

Code CSB-CF009338HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GDAP1
Uniprot No.
Alternative Names
GDAP1; Ganglioside-induced differentiation-associated protein 1; GDAP1
Species
Homo sapiens (Human)
Expression Region
1-358
Target Protein Sequence
MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPR VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNIL ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates the mitochondrial network by promoting mitochondrial fission.
Gene References into Functions
  1. This study showed that the characterization of GDAP1associated Charcot-Marie-Tooth disease. PMID: 29694336
  2. Study expands the mutational spectrum of GDAP1-related Charcot-Marie-Tooth (CMT) disease with the identification of new and unreported GDAP1 variants and demonstrates the predominance of the axonal form of neuropathy in CMT disease associated with GDAP1; highlights the clinical characteristics associated with these genotypes and describe the relative frequency of GDAP1 variants amongst the Chinese population. PMID: 29372391
  3. Study shows that GDAP1 is indeed a GST enzyme, and demonstrates a specific GSH-conjugating activity in vitro which seems to be regulated by the hydrophobic domain 1 (HD1) exerting an autoinhibitory function. HD1 could adopt an amphipathic pattern necessary to induce remodeling of organelles-mimicking liposomes by Gdap1. PMID: 27841286
  4. We identified GDAP1 variants in approximately 1% of our cohort with IPNs, and established a founder mutation in half of these patients. Our study originally described the mutational spectrum and clinical features of GDAP1-related CMT patients in Japan. PMID: 28244113
  5. This study report an AD-CMT2K with large phenotypic variability due to a novel dominant GDAP1 variant. PMID: 28236508
  6. GDAP1 hypomethylation can serve as a biomarker for alcohol dependence severity and treatment outcome. PMID: 27128683
  7. This study suggest GDAP1 as the first gene that should be analysed in Italian patients affected by CMT2. PMID: 26525999
  8. study reports on 2 Charcot-Marie-Tooth (CMT) families in which a newly identified Glu222Lys mutation within the GDAP1 gene segregates both in autosomal dominant and recessive traits PMID: 25337607
  9. The novelty of our data is the relatively high frequency of SH3TC2 and GDAP1 mutations in demyelinating and axonal forms, respectively, of Charcot-Marie-Tooth disease PMID: 25429913
  10. Results show that JPH1 and GDAP1 share a common pathway and depend on each other; therefore, JPH1 can contribute to the phenotypical consequences of GDAP1 mutations. PMID: 25168384
  11. GDAP1-associated polyneuropathy caused predominantly a mild and slowly progressive phenotype. PMID: 23456260
  12. This studies suggest that the pathophysiology of GDAP1-related CMT neuropathies may be associated with abnormal distribution and movement of mitochondria throughout cytoskeleton towards the ER and subplasmalemmal microdomains. PMID: 23542510
  13. GDAP1 regulates mitochondrial and peroxisomal fission by a similar mechanism. PMID: 23628762
  14. A novel heterozygous missense mutation (Arg120Gly) in the GDAP1 gene co-segregates with the disease within the pedigree of an Italian Charcot-Marie-Tooth disease type 2 (CMT2) family. PMID: 22971097
  15. This study suggested that the mutation of GDAP1 cased onion bulb-like formations of schwann cell in peripheral neuropathies. PMID: 23147504
  16. A French family with Charcot-Marie-Tooth disease is related to simultaneous heterozygous MFN2 and GDAP1 mutations. PMID: 22546700
  17. Patients of type 4 Charcot-Marie-Tooth disease showed reduced GDAP1 levels, GHS concentration and mitochondrial membrane potential. PMID: 21965300
  18. Charcot-Marie-Tooth-related gene GDAP1 complements cell cycle delay at G2/M phase in Saccharomyces cerevisiae fis1 gene-defective cells PMID: 21890626
  19. we report two recessive intermediate Charcot-Marie-Tooth (RI-CMT) patients with GDAP1 missense mutations PMID: 21692914
  20. We show that patients with dominant GDAP1 mutations may display clear axonal Charcot-Marie-Tooth disease PMID: 21753178
  21. Clinical outcome of Charcot-Marie-Tooth disease caused by mutations in the GDAP1 gene cannot be predicted solely on the basis of genetic results (missense/nonsense mutations). PMID: 21365284
  22. An p.R120W mutation has been identified in GDAP1 causing autosomal dominant Charcot-Marie-Tooth disease with a wide clinical profile. PMID: 21199105
  23. This review provide that Mitochondrial dysfunction and pathophysiology of Charcot-Marie-Tooth disease involving GDAP1 mutations. PMID: 20849849
  24. A mutations frquency of 27% in the GST domain of GDAP1 in the dominant form of axonal Charcot Marie Tooth type 2K was observed. PMID: 20685671
  25. Charcot-Marie-Tooth type 4C4 (CMT4C4) phenotype associated with the third recurrent GDAP1 mutation having a common origin in European population was characterized. PMID: 20232219
  26. different cellular mechanisms that disturb mitochondrial dynamics underlie the similar clinical manifestations caused by GDAP1 mutations, depending on the mode of inheritance PMID: 19782751
  27. GDAP1 is broadly expressed in cancer cell lines of different tissue origin. There is a consensus YY1 binding site in the GDAP1 core promoter. PMID: 19720140
  28. Mutations in GDAP1 are a frequent cause of autosomal recessive demyelinating Charcot-Marie-Tooth disease type 4A PMID: 12499475
  29. This study shows the variability of the phenotype associated with mutations in GDAP1 gene in terms of associated signs and severity of Charcot-Marie-Tooth disease. PMID: 12868504
  30. This study detected six distinct mutant alleles in four families, four of which are novel. PMID: 14561495
  31. Genetic analysis revealed a homozygous thymidine deletion at nucleotide position 558 resulting in a frameshift at codon 186 and a stop codon at position 205. PMID: 15019704
  32. may be related to the maintenance of the mitochondrial network PMID: 15772096
  33. In this study we report a novel mutation Met116Thr in the GDAP1 gene identified in a three generation Polish family with axonal CMT4. PMID: 16343542
  34. The patient of Charcot-Marie-Tooth with pyramidal feature has GDAP1 mutation(M116R). PMID: 16607474
  35. Like other cytosolic GSTs, GDAP1 protein has a dimeric structure. deletion of C-terminal transmembrane domain allowed preparation of soluble protein. purified protein was assayed for glutathione-dependent activity against a library of GST substrates. PMID: 16857173
  36. Two different point mutations, a novel R191X nonsense and a L239F missense mutation were detected in the GDAP1 gene causing Charcot-Marie-Tooth neurpathy. PMID: 17433678
  37. A novel C233T transversion at codon 78 (P78L) was detected in 6 patients from 3 unrelated families. PMID: 18062449
  38. A novel GDAP1 Q218E mutation in autosomal dominant Charcot-Marie-Tooth disease. PMID: 18231710
  39. A novel Pro153Leu mutation in the GDAP1 gene identified in a consanguineous Polish family as cause of Charcot-Marie-Tooth disease type 4C4. PMID: 18421898
  40. a novel GDAP1 mutation in an Old Order Amish family with autosomal recessive Charcot-Marie-Tooth disease. PMID: 18492089
  41. Data show that the mutations in the GDAP1 gene are a common cause of early-onset Autosomal recessive Charcot-Marie-Tooth syndrome (AR-CMT). PMID: 18504680
  42. clinical, electrophysiologic & genetic study of 2 patients with missense GDAP1 mutations with severe neuropathy; 1 mutation (Tyr279Cys) has not been reported before; despite similitude of mutations & electromyography, clinical course was different PMID: 18991200
  43. Data suggest that besides the regulatory role GDAP1 plays in mitochondrial network dynamics, it may also be involved in energy production and in the control of mitochondrial volume. PMID: 19089472
  44. this GDAP1 region contains critical overlapping motifs defining intracellular targeting by the tail anchor domain concomitant with functional aspects PMID: 19340293
  45. Data report a novel missense mutation and two polymorphisms in the ganglioside-induced differentiation-associated protein 1 gene identified in a five generation Turkish family with autosomal recessive Charcot-Marie-Tooth type 2. PMID: 19381883
  46. GDAP1 mutations should be considered both in recessive and sporadic cases of early-onset axonal Charcot-Marie-Tooth disease PMID: 19500985
  47. Thirty sequence variants have been found in the analysed genes from patients with Charcot-Marie-Tooth disorders: 5 pathogenic mutations in the GDAP1 gene and 2 pathogenic mutations in the PRX gene. PMID: 19837996

Show More

Hide All

Involvement in disease
Charcot-Marie-Tooth disease 4A (CMT4A); Charcot-Marie-Tooth disease, axonal, with vocal cord paresis, autosomal recessive (CMT2RV); Charcot-Marie-Tooth disease 2K (CMT2K); Charcot-Marie-Tooth disease, recessive, intermediate type, A (CMTRIA)
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Cytoplasm.
Protein Families
GST superfamily
Tissue Specificity
Highly expressed in whole brain and spinal cord. Predominant expression in central tissues of the nervous system not only in neurons but also in Schwann cells.
Database Links

HGNC: 15968

OMIM: 214400

KEGG: hsa:54332

STRING: 9606.ENSP00000220822

UniGene: Hs.168950

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×