Recombinant Human Glycine receptor subunit alpha-4(GLRA4)

Code CSB-CF689342HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5JXX5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence KEEVKSGTKGSQPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFSSITKT TMDYRVNVFLRQQWNDPRLSYREYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTD NKLLRIFKNGNVLYSIRLTLILSCLMDLKNFPMDIQTCTMQLESFGYTMKDLVFEWLEDA PAVQVAEGLTLPQFILRDEKDLGCCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLL IVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLF VFAALLEYAAINFVSRQHKEFIRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGG PMEGSGIYSPQPPAPLLREGETTRKLYVD
Source in vitro E.coli expression system
Gene Names GLRA4
Protein Names Recommended name: Glycine receptor subunit alpha-4
Expression Region 29-417
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine. Channel opening is also triggered by taurine and beta-alanine. Plays a role in the down-regulation of neuronal excitability. Contributes to the generation of inhibitory postsynaptic currents.
Subcellular Location Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell junction, synapse, Perikaryon, Cell projection, dendrite, Cell membrane, Multi-pass membrane protein
Protein Families Ligand-gated ion channel (TC 1.A.9) family, Glycine receptor (TC 1.A.9.3) subfamily, GLRA4 sub-subfamily
Tissue Specificity Detected in trachea smooth muscle.
Database Links

HGNC: 31715

KEGG: hsa:441509

STRING: 9606.ENSP00000361700

UniGene: Hs.533289

Related Products

GLRA4 Proteins

GLRA4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.