Recombinant Human Glycophorin-C (GYPC)

Code CSB-CF010076HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GYPC
Uniprot No.
Alternative Names
GYPC; GLPC; GPC; Glycophorin-C; Glycoconnectin; Glycophorin-D; GPD; Glycoprotein beta; PAS-2'; Sialoglycoprotein D; CD antigen CD236
Species
Homo sapiens (Human)
Expression Region
1-128
Target Protein Sequence
MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein is a minor sialoglycoprotein in human erythrocyte membranes. The blood group Gerbich antigens and receptors for Plasmodium falciparum merozoites are most likely located within the extracellular domain. Glycophorin-C plays an important role in regulating the stability of red cells.
Gene References into Functions
  1. The authors set out to understand the similarities and differences among the GYPC deletion alleles Yus and Gerbich by positional PCR sequence analysis to identify the breakpoints. They developed a set of diagnostic PCRs that can be used to classify both Yus and Gerbich phenotypic variants on the basis of their nucleotide deletion. The Yus phenotype was defined by 4 different breakpoints and the Ger PMID: 28272739
  2. Plasmodium falciparum STEVOR functions as an erythrocyte-binding protein that recognizes Glycophorin C (GPC) on the red blood cell (RBC) surface and that its binding correlates with the level of GPC on the RBC surface. PMID: 25011110
  3. Rosetting assays using CD236R knockdown normocytes derived from hematopoietic stem cells further supports the role of glycophorin C as a receptor in P vivax rosette formation. PMID: 24652986
  4. Precise definition of the binding site for the EBA-140 ligand on glycophorin C may be important with respect to human erythrocyte invasion inhibition strategies based on a receptor. PMID: 24379273
  5. Glycophorin C delta (exon3) is not associated with protection against severe anaemia in Papua New Guinea. PMID: 21061946
  6. The Gerbich blood group system PMID: 20932076
  7. The molecular evolution of GYPC among the Hominoidea (Greater and Lesser Apes) and the pattern of polymorphism at the locus in a global human sample, were examined. PMID: 19679754
  8. Recombinant Ge2, Ge3 & Ge4 antigens were cloned, expressed and purified. Yus and Ge mutants behaved in SDS-PAGE similarly to normal GPC forms with diffuse glycosylation. PMID: 12058555
  9. Data show that the receptor for Plasmodium falciparum erythrocyte-binding antigen 140 (EBA140) is glycophorin C (GYPC) and that this interaction mediates a principal P. falciparum invasion pathway into human erythrocytes. PMID: 12469115
  10. Glycophorin C is identified as the receptor for PfEBP-2, the erythrocyte binding ligand of Plasmodium falciparum, and the binding domain on GPC is determined to be amino acid residues 14 through 22 within exon 2. PMID: 12576308
  11. Neither mutation was associated with altered susceptibility to asymptomatic Plasmodium falciparum or P. vivax infection. Contribution of these erythrocyte polymorphisms to susceptibility to clinical malaria morbidity requires further study. PMID: 14695625
  12. A high GYPC gene expression is associated with an unfavorable outcome, in contrast, a high TRIP3 gene expression is associated with a favorable outcome in childhood ALL. PMID: 19149918

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type III membrane protein. Note=Linked to the membrane via band 4.1.
Protein Families
Glycophorin-C family
Tissue Specificity
Glycophorin-C is expressed in erythrocytes. Glycophorin-D and IsoGPC are ubiquitously expressed.
Database Links

HGNC: 4704

OMIM: 110750

KEGG: hsa:2995

STRING: 9606.ENSP00000259254

UniGene: Hs.59138

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×