Recombinant Human HEPACAM family member 2(HEPACAM2)

Code CSB-CF010288HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A8MVW5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence LKVTVPSHTVHGVRGQALYLPVHYGFHTPASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYIIKHGPRLEVASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLSPLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDVSGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE
Source in vitro E.coli expression system
Gene Names HEPACAM2
Protein Names Recommended name: HEPACAM family member 2 Alternative name(s): Mitotic kinetics regulator
Expression Region 32-462
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required during prometaphase for centrosome maturation. Following poly-ADP-ribosylation (PARsylation) by TNKS, translocates from the Golgi apparatus to mitotic centrosomes and plays a key role in the formation of robust microtubules for prompt movement of chromosomes
Subcellular Location Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Midbody
Tissue Specificity Widely expressed.
Database Links

HGNC: 27364

OMIM: 614133

KEGG: hsa:253012

STRING: 9606.ENSP00000377980

UniGene: Hs.443169

Related Products

HEPACAM2 Antibodies

HEPACAM2 Antibodies for Homo sapiens (Human)

HEPACAM2 Proteins

HEPACAM2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.