Recombinant Human HERV-K_11q22.1 provirus ancestral Env polyprotein

Code CSB-CF352224HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P61570
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence FIFTLIAVIMGLIAVTATGAVAGVALHSSVQSVNFVNDWQKNSTRLWNSQSSIDQKLANQ INDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDN LTLDISKLKEQIFKASKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILIL VCLFCLLLVCRCTQQL
Source in vitro E.coli expression system
Gene Names ERVK-25
Protein Names Recommended name: HERV-K_11q22.1 provirus ancestral Env polyprotein Alternative name(s): Envelope polyprotein Cleaved into the following 2 chains: 1. Surface protein Short name= 2. SU 3. Transmembrane protein Short name= 4. T
Expression Region 466-661
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution (By similarity).
Subcellular Location Virion, SUBCELLULAR LOCATION: Transmembrane protein: Cell membrane, Single-pass membrane protein
Protein Families Beta type-B retroviral envelope protein family, HERV class-II K(HML-2) env subfamily
Database Links

HGNC: 39039

Related Products

ERVK-25 Proteins

ERVK-25 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.