Recombinant Human HERV-K_1q22 provirus ancestral Env polyprotein

Code CSB-CF351062HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P61567
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence FIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNFVNDWQKNSTRLWNSQSSIDQKLANQ INDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDN LTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILIL VCLFCLLLVCRCTQQLRRDSDHRERAMMTMAVLSKRKGGNVGKSKRDQIVTVSV
Source in vitro E.coli expression system
Gene Names ERVK-7
Protein Names Recommended name: HERV-K_1q22 provirus ancestral Env polyprotein Alternative name(s): Envelope polyprotein HERV-K(III) envelope protein HERV-K102 envelope protein Cleaved into the following 2 chains: 1. Surface protein Short name=
Expression Region 355-588
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution.; FUNCTION
Subcellular Location Virion, SUBCELLULAR LOCATION: Transmembrane protein: Cell membrane, Single-pass membrane protein
Protein Families Beta type-B retroviral envelope protein family, HERV class-II K(HML-2) env subfamily
Tissue Specificity Expressed in lung, placenta, testis and peripheral blood lymphocytes.
Database Links

HGNC: 31828

OMIM: 614013

UniGene: Hs.678109

Related Products

ERVK-7 Proteins

ERVK-7 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.