Recombinant Human Histamine H2 receptor (HRH2)

Code CSB-CF010738HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Species
Homo sapiens (Human)
Expression Region
1-359
Target Protein Sequence
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. Also appears to regulate gastrointestinal motility and intestinal secretion. Possible role in regulating cell growth and differentiation. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and, through a separate G protein-dependent mechanism, the phosphoinositide/protein kinase (PKC) signaling pathway.
Gene References into Functions
  1. Pharmacological or genetic modulations of H2 and H4 HRs (H2R and H4R) not only suppressed gefitinib-induced cytostasis and differentiation of AML cells but also blocked EGFR and ERK1/2 inhibition in MDA-MB-231 cells PMID: 27180173
  2. High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the beta2-adrenergic receptor PMID: 26475619
  3. Lack of Association between rs2067474 Polymorphism in Histamine Receptor H2 Gene and Breast Cancer in Chinese Han Population PMID: 25922853
  4. Cimetidine reversed the exercise-induced improvement in learning and memory in rats. Central histamine H2 receptors play an important role in mediating the beneficial effects of forced exercise on learning and memory. PMID: 25192644
  5. upregulated on T regs following seasonal pollen exposure; allergen immunotherapy had no impact on the expression PMID: 24980224
  6. The inhibitory effects of histamine on reactive oxygen species production in whole blood phagocytes are caused by H2R rather than H4R histamine receptors. PMID: 24530738
  7. HR signaling through cyclic AMP and exchange protein directly activated by cyclic AMP was required for the histamine effect on LPS-induced monocyte-derived dendritic cells responses PMID: 23465664
  8. rs2607474 GG homozygote confers a significantly increased risk for age- and inflammation-related DAPK and CDH1 methylation in gastric epithelium. PMID: 23280118
  9. HR2 receptor is involved in histamine-induced GDF-15 expression. PMID: 22975449
  10. The results suggest that HRH2 -1018 GG homozygote is a risk factor for the severity of gastric mucosal atrophy under the influence of H. pylori infection, especially in older subjects. PMID: 22720301
  11. 1018 GG homozygosity of HRH2 may be associated with the severity of gastric mucosal atrophy PMID: 22615049
  12. Excitation of dentate nucleus neurons by histamine suggests that initiation and planning of movement is modulated by histaminergic projections. PMID: 21683759
  13. GRK2 induces desensitization of H2R through a phosphorylation-independent and RGS-dependent mechanism PMID: 21705320
  14. Results describe the interactions between human H2 receptor and its agonists. PMID: 21212009
  15. expression of H(2) during nicotinamide-induced differentiation of human amniotic epithelial cells into pancreatic beta-like cells may define a time-point, indicating involvement of histamine at the earlier stages PMID: 20012462
  16. histamine up-regulates LOX-1 expression via the H2 receptor in THP-1 monocytes PMID: 11728449
  17. Stimulation of phosphodiesterase IV is mediated by the H2 receptor and related to intracellular levels of cAMP. PMID: 12824943
  18. Data show that the rapid and prolonged modulation of cell surface histamine H2 receptor levels by histamine was regulated solely via internalization. PMID: 14523557
  19. significant differences in H2 receptor expression in different vascular cell types might play a critical role in histamine induced cellular responses PMID: 15167968
  20. human mast cells constitutively express primarily H2 and H4 receptors and that H2 receptors are functionally linked to cellular processes. PMID: 15191551
  21. Involvement of histamine H2 receptors in the histamine induced ets-1 expression in melanoma cells PMID: 15848191
  22. The equilibrium between receptor endocytosis and recycling is altered before H2R upregulation, probably via suppressing H2R degradation. PMID: 15961859
  23. histamine exerts both a proproliferative and a proangiogenic effect via H2/H4 receptor activation, mediated by increasing COX-2-related PGE2 production in COX-2-expressing colon cancer cells PMID: 16203768
  24. The point mutation Cys-17 to Tyr-17 in the human histamine H2 receptor results in the formation of an H-bond between Tyr-17 and Asp-271 , favoring the stabilization of an active receptor conformation. PMID: 17347323
  25. HRH2 trafficking was analyzed by examination of the roles of arrestin, dynamin, and clathrin on HRH2 internalization. PMID: 18617631
  26. These results suggest that the agonist-induced H2R internalization and ERK1/2 activation are partially dynamin-dependent. Furthermore, ERK1/2 activation via H2R is likely dependent of the endocytotic process rather than dynamin itself. PMID: 18691388
  27. role in allergy, autoimmunity, graft rejection, malignancy PMID: 18802338
  28. H2r exposure to an agonist caused desensitization controlled by H2r phosphorylation via GRK2 and GRK3. PMID: 11641433
  29. Histamine H2 receptors regulate intracellular Ca2+ levels exclusively by activation of nonselective cation channels, an effect which is inhibited via specific activation of protein kinase C isoform. PMID: 11466390

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 5183

OMIM: 142703

KEGG: hsa:3274

STRING: 9606.ENSP00000366506

UniGene: Hs.247885

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1