Recombinant Human Hyaluronan synthase 1 (HAS1)

Code CSB-CF010139HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
HAS1; HAS; Hyaluronan synthase 1; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1; HuHAS1
Species
Homo sapiens (Human)
Expression Region
1-578
Target Protein Sequence
MRQQDAPKPTPAACRCSGLARRVLTIAFALLILGLMTWAYAAGVPLASDRYGLLAFGLYG AFLSAHLVAQSLFAYLEHRRVAAAARGPLDAATARSVALTISAYQEDPAYLRQCLASARA LLYPRARLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGA GAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQVCDSDT RLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERACQSYFH CVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKYTSRSR CYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVL RLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLAL VTMNQSGWGTSGRRKLAANYVPLLPLALWALLLLGGLVRSVAHEARADWSGPSRAAEAYH LAAGAGAYVGYWVAMLTLYWVGVRRLCRRRTGGYRVQV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction. Also able to catalyze the synthesis of chito-oligosaccharide depending on the substrate.
Gene References into Functions
  1. hyaluronic acid synthase-1 promotes malignant transformation via epithelial-to-mesenchymal transition, micronucleation and centrosome abnormalities PMID: 29137675
  2. our study indicated a HAS1-miR214-SOX-4 pathway in regulating the growth and metastasis of Esophageal squamous cell carcinoma (ESCC) , providing a promising target for ESCC therapy PMID: 28656277
  3. Reduced expression of HAS1 and HAS2 is associated with melanoma progression and suggests that HAS1 and HAS2 have a prognostic significance in cutaneous melanoma. PMID: 27184066
  4. The minor allele genotypes of HAS1 SNPs are significantly more frequent in MM, WM, CLL and in affected members of a monoclonal gammopathy-prone family than they are in breast cancer, sporadic MGUS or healthy donors PMID: 24950197
  5. transcriptional regulation of the HAS and HAS2-antisense RNA 1 genes, was analyzed. PMID: 25325984
  6. HAS1 is the main enzyme responsible for hyaluronan production by normal keratinocytes. PMID: 24658508
  7. The HAS1-dependent coat is induced by inflammatory agents and glycemic stress, mediated by altered presentation of either CD44 or hyaluronan, and can offer a rapid cellular response to injury and inflammation. PMID: 24099991
  8. Among the genes affected by FAK or HAS3 inhibition were genes, playing role in apoptosis, cell cycle regulation, adhesion, transcription, heatshock and WNT pathways. PMID: 22934709
  9. Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma. PMID: 23560496
  10. aberrant intronic HAS1 splicing in multiple myeloma patients may rely on intronic HAS1 deletions and mutations that are frequent in MM patients but absent from healthy donors PMID: 23301075
  11. TGF-beta1 up-regulation of HAS1 transcription was mediated via Smad3 but not Smad2, while HAS1 induction by IL-1beta was Sp3, not Sp1, dependent. PMID: 23123404
  12. Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3 PMID: 23303191
  13. HA chains synthesized by HAS1 and HAS2 contribute to outflow resistance, while hyaluronan produced by HAS3 does not appear to play a significant role. PMID: 22695958
  14. analysis of changes in cervical glycosaminoglycan composition during normal pregnancy and preterm birth: Has1 is expressed in preterm birth, while Has2 is induced at term PMID: 22529214
  15. this study provides strong evidence that HAS1-driven Hyaluonan-synthesis is a target of estradiol in human vascular smooth muscle cells PMID: 21901291
  16. HYAL-1 and HAS1 expression predicted bladder cancer metastasis, and HYAL-1 expression also predicted disease-specific survival. PMID: 20960509
  17. Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma PMID: 20875124
  18. Data show that a significant in expression levels of HA synthases (HASs) and hyaluronidases (Hyals) was observed in vitro on stimulation of epithelial ovarian carcinoma cells by gonadotropins. PMID: 20072653
  19. hyaluronan synthase expression in prostate adenocarcinoma cells PMID: 11790779
  20. characterization of expression and hyaluronan synthesis in bone marrow mesenchymal progenitor cells: predominant expression of mRNA and up-regulated hyaluronan synthesis in bone marrow cells derived from multiple myeloma patients PMID: 12239172
  21. Expression of HAS1 in Waldenstrom's macroglobulinemia. Variants of HAS1 synthesize the intracellular HA ligand for RHAMM and may contribute to genetic instability in Waldenstrom's macroglobulinemia. PMID: 12720129
  22. Expression of each hyaluronan synthase isoform is regulated differently by growth factors and cytokines in vascular endothelial cells. Expressed in proliferative membranes from proliferative vitreoretinal diseases. May affect progression of diseases. PMID: 14636845
  23. hyaluronan synthase 1 variants have a role in progression of multiple myeloma PMID: 15731173
  24. Increased HAS1 expression and an increase in serum hyaluronan in endometrial cancer may be associated with disease progression through myometrial invasion and lymph-vascular space involvement PMID: 15870928
  25. IkappaB kinase and IkappaBalpha reveal NF-kappaB-dependent as well as NF-kappaB-independent pathways of HAS1 activation PMID: 16258173
  26. mRNA for HAS1 is undetectable but HAS3 mRNA can be readily detected in freshly isolated CD133+ as well as in CD133- umbilical cord blood (UCB) cells. mRNA for HAS2 can only be detected in CD133+ progenitor cells. PMID: 16564133
  27. Evidence is provided that in type-B synoviocytes (TBS) HAS1 is a gene that depends on the transcription factor nuclear factor kappa B (NF-kappaB) for its activation. PMID: 16723203
  28. The aim of this study was to evaluate how TNF-alpha, IFN-gamma,IL-1beta, and exposition to oxidative stress may modulate HAS activities in normal human skin fibroblasts. PMID: 16786194
  29. Interleukin-1beta stimulation resulted in induction of HAS1 and HAS2 transcription but did not induce phenotypic differentiation or induce hyaluronan coat assembly PMID: 17611197
  30. HAS1 captured in this pull-down approach is readily immunodetected by Western blot analysis using appropriate antibodies. PMID: 17904513
  31. Treatment of fibroblasts with growth factors up-regulated HAS gene expression and increased HAS enzymes and HA production. PMID: 17922656
  32. HAS1 regulates bladder cancer growth and progression by modulating hyaluronic acid synthesis and hyaluronic acid receptor levels. PMID: 18199543
  33. HAS1 is activated by Epstein-Barr virus and synthetic double- and single-stranded viral RNA analogs PMID: 18400745
  34. genetic contributions toward aberrant splicing of the HAS1 gene in multiple myeloma and Waldenstrom macroglobulinemia were characterized; 3616 bp in HAS1 exons and introns involved in aberrant splicing, from 17 patients were sequenced PMID: 18815290
  35. HAS expression in human articular chondrocytes during the de- and re-differentiation processes. PMID: 19148550
  36. By intensive sequencing of the hyaluronan synthase 1 (HAS1) gene in malignant and normal cells from patients with WM, we have identified both types of mutation in HAS1 exons and introns. PMID: 19362966
  37. HAS1, HAS2 and HAS3 expression is not consistently elevated in ovarian carcinomas. PMID: 19435493
  38. HAS1 (Hyaluronan Synthase 1) splice variants multimerize with and modulate normally spliced HAS1 protein PMID: 19451652
  39. Transfection with siHAS2 and siHAS1 showed that mainly HAS1 synthesized high molecular weight HA regulates HT1080 cell motility. PMID: 19577615
  40. HAS activity can be modulated by post-translational modification, such as phosphorylation and N-glycosylation PMID: 19737932

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
NodC/HAS family
Tissue Specificity
Widely expressed. Highly expressed in ovary followed by spleen, thymus, prostate, testes and large intestine. Weakly expressed in small intestine.
Database Links

HGNC: 4818

OMIM: 601463

KEGG: hsa:3036

STRING: 9606.ENSP00000222115

UniGene: Hs.57697

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1