Recombinant Human Hyaluronan synthase 1(HAS1)

Code CSB-CF010139HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q92839
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MRQQDAPKPTPAACRCSGLARRVLTIAFALLILGLMTWAYAAGVPLASDRYGLLAFGLYG AFLSAHLVAQSLFAYLEHRRVAAAARGPLDAATARSVALTISAYQEDPAYLRQCLASARA LLYPRARLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGA GAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQVCDSDT RLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERACQSYFH CVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKYTSRSR CYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVL RLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLAL VTMNQSGWGTSGRRKLAANYVPLLPLALWALLLLGGLVRSVAHEARADWSGPSRAAEAYH LAAGAGAYVGYWVAMLTLYWVGVRRLCRRRTGGYRVQV
Source in vitro E.coli expression system
Gene Names HAS1
Protein Names Recommended name: Hyaluronan synthase 1 EC= 2.4.1.212 Alternative name(s): Hyaluronate synthase 1 Hyaluronic acid synthase 1 Short name= HA synthase 1 Short name= HuHAS1
Expression Region 1-578
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction. Also able to catalyze the synthesis of chito-oligosaccharide depending on the substrate (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families NodC/HAS family
Tissue Specificity Widely expressed. Highly expressed in ovary followed by spleen, thymus, prostate, testes and large intestine. Weakly expressed in small intestine.
Database Links

HGNC: 4818

OMIM: 601463

KEGG: hsa:3036

STRING: 9606.ENSP00000222115

UniGene: Hs.57697

Related Products

HAS1 Antibodies

HAS1 Antibodies for Homo sapiens (Human)

HAS1 Antibodies for Human

HAS1 Proteins

HAS1 Proteins for Homo sapiens (Human)

HAS1 ELISA Kit

HAS1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.