Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5)

Code CSB-CF011028HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
IFITM5
Uniprot No.
Alternative Names
IFITM5; Interferon-induced transmembrane protein 5; Bone-restricted interferon-induced transmembrane protein-like protein; BRIL; Dispanin subfamily A member 1; DSPA1
Species
Homo sapiens (Human)
Expression Region
1-132
Target Protein Sequence
MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA FFSTKFDDADYD
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for normal bone mineralization.
Gene References into Functions
  1. Two mutations in IFITM5 causing distinct forms of osteogenesis imperfect. PMID: 24478195
  2. The point mutation, c.-14C>T in the 5'-untranslated region of IFITM5, is responsible for osteogenesis imperfecta type V in Chinese patients. PMID: 23977282
  3. The IFITM5 5' UTR was sequenced in 9 heterozygous subjects with osteogenesis imperfecta type V. Both wild-type and mutant IFITM5 mRNA transcripts were present in bone. Identical mutations have variable phenotypic expression, even within the same family. PMID: 24674092
  4. The bone mineral density varied greatly, even within families. Our study thus highlights the phenotypic variability of OI type V caused by the IFITM5 mutation. PMID: 23408678
  5. Recurrent mutation in the 5'-UTR of IFITM5 causes osteogenesis imperfecta type V. PMID: 23813632
  6. IFITM5 mutation is associated with Osteogenesis imperfecta type V. PMID: 23804581
  7. study demonstrates the presence of a recurrent IFITM5 mutation in a population of patients with osteogenesis imperfecta type V; even though the disease-causing mutation is identical among patients, the interindividual phenotypic variability is considerable PMID: 23240094
  8. A single recurrent mutation in the 5'-UTR of IFITM5 causes osteogenesis imperfecta type V. PMID: 22863190
  9. A mutation in the 5'-UTR of IFITM5 creates an in-frame start codon and causes autosomal-dominant osteogenesis imperfecta type V with hyperplastic callus. PMID: 22863195

Show More

Hide All

Involvement in disease
Osteogenesis imperfecta 5 (OI5)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
CD225/Dispanin family
Tissue Specificity
Detected in bone. Detected in osteoblasts and fibroblasts (at protein level). Detected in bone. Detected in osteoblasts and fibroblasts.
Database Links

HGNC: 16644

OMIM: 610967

KEGG: hsa:387733

STRING: 9606.ENSP00000372059

UniGene: Hs.443469

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×