Recombinant Human JNK1/MAPK8-associated membrane protein(JKAMP)

Code CSB-CF873717HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9P055
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MFGAAARSADLALLEKNLQAAHGCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKY CQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIIT LLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCL VLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLS LVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVP TPALFYLFTAKFTEPSRILSEGANGH
Source in vitro E.coli expression system
Gene Names JKAMP
Protein Names Recommended name: JNK1/MAPK8-associated membrane protein Short name= JKAMP Alternative name(s): JNK1-associated membrane protein Short name= JAMP Medulloblastoma antigen MU-MB-50.4
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be a regulator of the duration of MAPK8 activity in response to various stress stimuli. Facilitates degradation of misfolded endoplasmic reticulum (ER) luminal proteins through the recruitment of components of the proteasome and endoplasmic reticulum-associated degradation (ERAD) system (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Database Links

HGNC: 20184

OMIM: 611176

KEGG: hsa:51528

STRING: 9606.ENSP00000261247

UniGene: Hs.446850

Related Products

JKAMP Proteins

JKAMP Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.