Recombinant Human KiSS-1 receptor (KISS1R)

Code CSB-CF850246HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
KISS1R; AXOR12; GPR54; KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; hOT7T175; Hypogonadotropin-1; Kisspeptins receptor; Metastin receptor
Species
Homo sapiens (Human)
Expression Region
1-398
Target Protein Sequence
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for metastin (kisspeptin-54 or kp-54), a C-terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein that suppresses metastases in malignant melanomas and in some breast carcinomas without affecting tumorigenicity. The metastasis suppressor properties may be mediated in part by cell cycle arrest and induction of apoptosis in malignant cells. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. The receptor is also probably involved in the regulation and fine-tuning of trophoblast invasion generated by the trophoblast itself. Analysis of the transduction pathways activated by the receptor identifies coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins.
Gene References into Functions
  1. The study shows that KISS1R mutants are responsible for the normosmic congenital hypogonadotrophic hypogonadism phenotype in only a small minority of cases PMID: 27094476
  2. Kisspeptin-10 may contribute to accelerate the progression and instability of atheromatous plaques, leading to plaque rupture. The GPR54 antagonist may be useful for prevention and treatment of atherosclerosis. PMID: 28411243
  3. The missense variant (c.1091Tgt;A) was a nonsynonymous polymorphism that induces amino acid substitution of p.Leu364His. The haplotype CAGTGTC was detected more frequently in the central precocious puberty group. PMID: 27914139
  4. Metabolism and Energy Expenditure, But Not Feeding or Glucose Tolerance, Are Impaired in Young Kiss1r KO Female Mice PMID: 27649089
  5. Neuropeptide derivatives to regulate the reproductive axis: Kisspeptin receptor (KISS1R) ligands and neurokinin-3 receptor (NK3R) ligands. PMID: 27271543
  6. In human cumulus GCs, kiss1r mRNA levels were positively correlated with age but not with BMI. There was no expression of kiss1 mRNA in either cumulus or mural GCs PMID: 26879207
  7. KISS1R signaling induces invadopodia formation and activation of key invadopodia proteins, cortactin, cofilin and membrane type I matrix metalloproteases (MT1-MMP). PMID: 26721186
  8. KISS1R Low Expression Correlates with Colorectal Liver Metastasis. PMID: 26471489
  9. KiSS1 is a metastasis suppressor gene of pancreatic cancer, and this suppression is not dependent on the expression levels of GPR54. PMID: 26572251
  10. confirmed that mutations in KISS1 and KISS1R are not a common cause for ICPP PMID: 23950571
  11. Two novel heterozygous missense mutations in FGFR1 and one novel heterozygous missense mutation in KISS1R, were identified in in Chinese Kallmann Syndrome Males with Cleft Lip/Palate. PMID: 26199944
  12. The majority of human non-functioning pituitary tumors expressed KISS1R with lower rates of expression in other types of pituitary tumors. PMID: 24817066
  13. The promoter of GPR54 is unmethylated in normal endometrium PMID: 24908069
  14. Present data do not confirm the protective role of KiSS1/KiSS1R in breast cancer progression, but our results do support the hypothesis that KiSS1/KiSS1R system is activated even in primary breast cancer and sustained during invasion to local lymph nodes. PMID: 25535062
  15. Normosmic idiopathic hypogonadotropic hypogonadism due to a novel homozygous nonsense c.C969A (p.Y323X) mutation in the KISS1R gene in three unrelated families. PMID: 25262569
  16. A number of mutations in KISS1 KISS1R are associated with central precocious puberty and isolated hypogonadotropic hypogonadism. (Review) PMID: 26510589
  17. No KISS1R expression was detected in normal or malignant tissues or in liver metastases. PMID: 26010933
  18. Reduction of Kiss-1R expression is linked to poor prognosis for colorectal cancer patients. PMID: 25260785
  19. Decreased expression of KISS1R seems to attenuate signaling of the KISS1/KISS1R system, possibly leading to tumor growth PMID: 25667462
  20. data indicate that GPR54 and TACR3 gene mutations are not a frequent cause of ICPP. The identified A/G synonymous SNP (dbSNP ID: rs10407968) located in exon 1 of the gene is not likely to have a pathogenic role in exon splicing PMID: 24434351
  21. Kisspeptin, GPR54 and PIBF expressions in syncytiotrophoblasts and cytotrophoblasts were decreased in recurrent spontaneous abortion women as compared to controls PMID: 24225150
  22. Sustained calcium response to kisspeptin is dependent on the continued presence of extracellular ligand and is the result of dynamic KISS1R trafficking. PMID: 24295737
  23. High GPR54 expression is associated with breast cancer. PMID: 24596387
  24. The downregulation of Kiss-1 has been shown to correlate with decreased Kiss-1R expression, which is inversely associated with clinical stage and tumour grade. [Review] PMID: 23969598
  25. cumulative survival rate of patients with KISS1 or KISS1R expression was significantly higher compared to that without expression. KISS1 or KISS1R expression in non-small cell lung cancer can be used to indicate favorable prognosis for disease outcome. PMID: 23716269
  26. The additiona of a PRR repeat into a proline-arginine-rich motif can dramatically change the conformation of the intracellular domain of KISS1R and its probable interaction with partner proteins. PMID: 23608644
  27. Data show that that the expression of Kiss1 Kiss1R and MMP9 were higher in the placenta compared to the placental bed and decidua parietalis. PMID: 23696833
  28. mutations with confirmed association with idiopathic central precocious puberty were identified in kisspeptin and KISS1R. These observations underscore the role of KISS1R signaling for normal pubertal development. PMID: 23550005
  29. Structure, synthesis, and phylogeny of kisspeptin and its receptor. PMID: 23550000
  30. Both sets of neurons project to GnRH cell bodies, which contain Kiss1r, and the ARC kisspeptin population also projects to GnRH axons in the median eminence. PMID: 23550001
  31. Data suggest that the ERalpha status of mammary cells dictates whether KISS1R may be a novel clinical target for treating breast cancer metastasis. PMID: 23525242
  32. Data show that a loss-of-function mutation (p.Tyr313His) in the KISS1R gene can cause familial congenital hypogonadotropic hypogonadism (nCHH), revealing the crucial role of this amino acid in KISS1R function PMID: 23349759
  33. study suggests that negative expression of metastin receptor in clear cell RCC is significantly related to metastasis PMID: 23277422
  34. Negative fetal FSH/LH regulation in late pregnancy is associated with declined kisspeptin/KISS1R expression in the tuberal hypothalamus. PMID: 23015653
  35. KISS1R-expressing cells undergo sustained kisspeptin-induced signaling that is dependent upon an influx of extracellular Ca2+ PMID: 23070548
  36. The subnormal gonadal response to hCG in patients may implicate a direct role of KISS1R in gonadal function and fetal development of male external genitalia. PMID: 22619348
  37. Results suggest that findings of increased kisspeptin receptor (KISS1R) expression may represent a mechanism by which functional activity of kisspeptin (KISS1) is higher in pre-eclampsia (PE) than in normal pregnancy. PMID: 22526494
  38. NKB/NK(3)R and kisspeptin/KISS1R are present in female peripheral reproductive tissues with colocalization of both systems in some non-neuronal cell populations of the human female genital tract. PMID: 22424618
  39. Data suggest that the KISS1/KISS1R system may play a role in the pathophysiology of endometriosis only for a particular group of patients. PMID: 22210725
  40. Compared to Kiss-1 protein, GPR54 expression was mainly present in syncytiotrophoblasts and deciduas, but not in cytotrophoblasts of women with recurrent pregnancy loss. PMID: 21996032
  41. Kisspeptin and its receptor are expressed in the human, rat and mouse heart and kisspeptins possess potent positive inotropic activity. PMID: 22132116
  42. Studies indicate that KISS1R is degraded by the proteasome, as opposed to the classic lysosomal degradation described for most G protein-coupled receptors. PMID: 21912371
  43. KISS1 and KISS1R expression in the human and rat carotid body and superior cervical ganglion. PMID: 22193294
  44. Data show that endometrial cancer overall survival is improved with high expression of GPR54 and that GPR54 expression is associated with known prognostic factors. PMID: 21282360
  45. This chapter describes the kisspeptin-GPR54 complex physiology and its current role in human diseases. PMID: 20374724
  46. A novel loss-of-function mutation in the GPR54 gene is associated with familial normosmic idiopathic hypogonadotropic hypogonadism PMID: 21193544
  47. The Arg386Pro mutation does not affect the rate of KISS1R trafficking--instead, it prolongs responsiveness to kisspeptin by decreasing KISS1R degradation, resulting in the net increase on mutant receptor recycled back to the plasma membrane. PMID: 21285314
  48. Results provide primary evidence that KISS1 and KISS1R expression can be differentially lost in pituitary tumor subtypes. PMID: 21169415
  49. One novel homozygous KISS1R mutation was identified in two siblings with normosmic isolated hypogonadotropic hypogonadism. PMID: 20371656
  50. Inactivating mutations of the KISS1 receptor cause isolated hypogonadotropic hypogonadism. PMID: 20237166

Show More

Hide All

Involvement in disease
Hypogonadotropic hypogonadism 8 with or without anosmia (HH8); Precocious puberty, central 1 (CPPB1)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Most highly expressed in the pancreas, placenta and spinal cord, with lower-level of expression in peripheral blood leukocytes, kidney, lung, fetal liver, stomach, small intestine, testes, spleen, thymus, adrenal glands and lymph nodes. In the adult brain
Database Links

HGNC: 4510

OMIM: 176400

KEGG: hsa:84634

STRING: 9606.ENSP00000234371

UniGene: Hs.208229

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1