Recombinant Human Leucine-rich repeat-containing protein 3B (LRRC3B)

Code CSB-CF857000HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
LRRC3B
Uniprot No.
Alternative Names
LRRC3B; LRP15; UNQ195/PRO221; Leucine-rich repeat-containing protein 3B; Leucine-rich repeat protein 15
Species
Homo sapiens (Human)
Expression Region
34-259
Target Protein Sequence
CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVL NLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTL QQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGW FTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. The expression of LRRC3B is downregulated in non-small cell lung cancer compared with normal epithelial cells. PMID: 27118644
  2. LRRC3B may serve as an important tumor suppressor in non-small-cell lung cancer PMID: 26276358
  3. LRRC3B gene expression and promoter hypermethylation in breast carcinomas PMID: 24839112
  4. Data suggest that LRRC3B gene could be involved in the process of carcinogenesis as a tumor suppressor gene. PMID: 22321817
  5. The LRRC3B gene promoter was methylated in 43% of clear cell renal carcinoma samples. PMID: 22101383
  6. The expression of LRP15 is controlled by methylation in its promoter in HeLa cells, and LRP15 confers resistance to ultraviolet rays damage and accelerates the DNA repair rate. PMID: 18377727
  7. suggest that LRRC3B is a putative tumor suppressor gene that is silenced in gastric cancers by epigenetic mechanisms and that LRRC3B silencing in cancer may play an important role in tumor escape from immune surveillance PMID: 18757430
  8. LRRC3B may be a novel methylation-sensitive tumor suppressor gene in CRC. LRRC3B methylation has significant tumor specificity and may be a biomarker of CRC. PMID: 18815942

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Protein Families
LRRC3 family
Database Links

HGNC: 28105

KEGG: hsa:116135

STRING: 9606.ENSP00000379880

UniGene: Hs.517868

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1