Recombinant Human Lysosomal-associated transmembrane protein 5 (LAPTM5)

Code CSB-CF622667HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
LAPTM5
Uniprot No.
Alternative Names
LAPTM5; KIAA0085; Lysosomal-associated transmembrane protein 5; Lysosomal-associated multitransmembrane protein 5; Retinoic acid-inducible E3 protein
Species
Homo sapiens (Human)
Expression Region
1-262
Target Protein Sequence
MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI ADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAY LKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYE EALSLPSKTPEGGPAPPPYSEV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May have a special functional role during embryogenesis and in adult hematopoietic cells.
Gene References into Functions
  1. These findings suggest that the inactivation of LAPTM5 may contribute to tumorigenesis in a subset of human cancers PMID: 27058622
  2. Taken together, our results suggested that decreased LAPTM5 inhibited proliferation and viability, as well as induced G0/G1 cell cycle arrest possibly via deactivation of ERK1/2 and p38 in BCa cells PMID: 27922670
  3. Insufficient expression of LAPTM5 may take part in the pathogenesis of systemic lupus erythematosus (SLE) and contribute to the severity of the disease, none of LAPTM5 polymorphisms contributes significantly to SLE susceptibility in a Chinese population. PMID: 25998573
  4. The interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments both suggest that LAPTM5 might influence the role of CD1e in the presentation of lipid antigens. PMID: 22880058
  5. LAPTM5 is a substrate of the ITCH-mediated degradation and its protein level is negatively regulated by ITCH PMID: 22009753
  6. LAPTM5-mediated programmed cell death is closely associated with the spontaneous regression of neuroblastomas PMID: 19787053
  7. LAPTM5 shows stage-specific expression during B cell differentiation. It may be involved in B cell malignancies. PMID: 12527926
  8. results suggest that loss of E3 gene expression might be a crucial event during the progression of human MM PMID: 12886255

Show More

Hide All

Subcellular Location
Lysosome membrane; Multi-pass membrane protein.
Protein Families
LAPTM4/LAPTM5 transporter family
Tissue Specificity
Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. Highly expressed in peripheral blood leukocytes, thymus, spleen and lung, followed by placenta, liver and kidney.
Database Links

HGNC: 29612

OMIM: 601476

KEGG: hsa:7805

STRING: 9606.ENSP00000294507

UniGene: Hs.371021

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1