Product Details

Target Names

MARVELD2

Uniprot No.

Q8N4S9

Alternative Names

MARVELD2; TRIC; MARVEL domain-containing protein 2; Tricellulin

Species

Homo sapiens (Human)

Expression Region

1-558

Target Protein Sequence

MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPD FYSSDTEEPAIAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPAS PARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYN LRYSYMKSWAGLLRILGVVELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLG SMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL FILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISAL VCLKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMK PELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVL RKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIK QRIQEYDKVMNWDVQGYS

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Plays a role in the formation of tricellular tight junctions and of epithelial barriers. Required for normal hearing via its role in the separation of the endolymphatic and perilymphatic spaces of the organ of Corti in the inner ear, and for normal survival of hair cells in the organ of Corti.

Gene References into Functions

this study shows that tricellulin is regulated via interleukin-13-receptor alpha2, affects macromolecule uptake, and is decreased in ulcerative colitis PMID: 28612843
Our results provide new insights into the function of tricellulin, and its nuclear localization may become a new prognostic factor for pancreatic cancers. PMID: 27641742
GSK3beta may inhibit VRK2 catalytic activity by disrupting its flexibility. The inhibition of VRK2 catalytic activity by GSK3beta may also inhibit VRK2-induced degradation of TRiC, which could suppress polyQ-expanded Htt aggregation. PMID: 27377031
Tricellulin-dependent macromolecule passage was comparably regulated in leaky and tight epithelia, but relative and absolute ion permeabilities of the tricellular tight junction (tTJ) were different. PMID: 28605032
we demonstrated that PLG functions as a molecular bridge between tricellulin and streptococcal surface enolase (SEN). The wild type strain efficiently translocated across the epithelial monolayer, accompanied by cleavage of transmembrane junctional proteins. PMID: 26822058
The expressions of MARVELD2, CLDN1 and CLDN3 mRNA were significantly lower in cholesteatoma tissue and may be involved in epithelium permeability. PMID: 25319490
High tricellulin expression is associated with hepatocellular carcinoma. PMID: 24652413
MARVELD2 variants are responsible for about 1.5 % (95 % CI 0.8-2.6) of non-syndromic hearing loss in our cohort of 800 Pakistani families. The c.1331+2T>C allele is recurrent. PMID: 25666562
The findings show the heterogeneity of the molecular organization of tTJs in terms of the content of LSR, ILDR1 or ILDR2, and suggest that ILDR1-mediated recruitment of tricellulin to TCs is required for hearing. PMID: 23239027
This study reveals the presence and subcellular distribution of tricellulin in brain endothelial cells. PMID: 23250572
The dynamic behavior of tricellulin during the destruction and formation of tight junctions (TJ) under various extracellular calcium conditions seems to be closely associated with the barrier and fence functions of TJs. PMID: 23073616
DFNB49 is an important cause of non-syndromic deafness in Czech Roma patients but not in the general Czech population. PMID: 22097895
the tricellulin expression profile in normal and neoplastic human pancreas PMID: 22394074
tricellulin and its role in tight junction formation and maintenance PMID: 21868126
tricellulin is markedly reduced at all stages of tumor development. In situ hybridization analysis showed no correlation between HPV infection and altered expression of the tight junction proteins. PMID: 21480761
the expression of tricellulin both in microglia and in the stomach immune cells point to a possible role of this new tight junctions protein in the immune system. PMID: 21624353
JNK may be involved in the regulation of tricellular tight junctions including TRIC expression and the barrier function in pancreatic duct epithelial cells. PMID: 20533305
These results suggest that tricellulin is stably expressed in human nasal epithelial cells and may play an important role for the sealing of the corner at tricellular contacts to prevent infiltration by various inhaled viruses and antigens. PMID: 20033365
Maps to 5q12.3-q14.1. PMID: 15538632
Splice-site mutations in the TRIC gene underlie autosomal recessive nonsyndromic hearing impairment PMID: 18084694
Data suggest that at low tricellulin expression the tricellular tight junction central tube forms a pathway, but at higher expression tricellulin forms a barrier for macromolecules in tricellular TJs and in bicellular TJs for solutes of all sizes. PMID: 19535456
Differential phosphorylation of tricellulin by casein kinase 1 (CK1) and casein kinase 2 PMID: 19538290
TRiC does not physically block the polyQ tract of Htt itself, but rather sequesters a short Htt sequence element, N-terminal to the polyQ tract, that promotes the amyloidogenic conformation. PMID: 19915590

Hide All

Involvement in disease

Deafness, autosomal recessive, 49 (DFNB49)

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.

Database Links

HGNC: 26401

OMIM: 610153

KEGG: hsa:153562

STRING: 9606.ENSP00000323264

UniGene: Hs.657687

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF818704HU
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human MARVEL domain-containing protein 2 (MARVELD2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage