Recombinant Human Matrix metalloproteinase-16 (MMP16)

Code CSB-CF014663HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MMP16
Uniprot No.
Alternative Names
MMP16; C8orf57; MMPX2; Matrix metalloproteinase-16; MMP-16; MMP-X2; Membrane-type matrix metalloproteinase 3; MT-MMP 3; MTMMP3; Membrane-type-3 matrix metalloproteinase; MT3-MMP; MT3MMP
Species
Homo sapiens (Human)
Expression Region
120-607
Target Protein Sequence
YALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endopeptidase that degrades various components of the extracellular matrix, such as collagen type III and fibronectin. Activates progelatinase A. Involved in the matrix remodeling of blood vessels. Isoform short cleaves fibronectin and also collagen type III, but at lower rate. It has no effect on type I, II, IV and V collagen. However, upon interaction with CSPG4, it may be involved in degradation and invasion of type I collagen by melanoma cells.
Gene References into Functions
  1. Overexpression of MMP2 and MMP16 in endometrial cancerous tissues corresponded to down-regulation of miR-377, miR-382 and miR-410, while decreased expression of TIMP2 was associated with miR-200b up-regulation. PMID: 28871006
  2. MMP16 was highly expressed and correlated with poor prognosis in gastric cancer patients by promoting proliferation and invasion of gastric cancer cells PMID: 27340864
  3. the present findings indicate that MT3-MMP is down-regulated in ESCC, which correlates to lymph node metastasis and poor survival of patients with this disease. PMID: 27292876
  4. more severe intervertebral disc degeneration is correlated with higher matrix metallopeptidase 16 PMID: 27227700
  5. results suggest that miR-145 functions as a tumor metastasis suppressor gene by down-regulating MMP16 and may be a potential target in osteosarcoma treatment PMID: 26605780
  6. the results support a role for MMP16 in promoting invasive properties of the meningioma tumours PMID: 24989599
  7. These results demonstrate that the MT3-MMP promoter is frequently hypermethylated in colorectal cancer and that downregulation of MT3-MMP may be important for cell migration in colorectal cancer. PMID: 26002729
  8. MMP16 is a putative indicator of adverse melanoma prognosis. PMID: 25808867
  9. Expression of MMP-16 in HTB9 and T24 cells increases following transforming growth factorbeta1 treatment. PMID: 25017509
  10. E2F1 acts as a transcriptional activator for MMPs and directly enhances MMP transcription by binding to E2F1 binding sequences in the promoter, or indirectly activates MMPs (MMP-9 and MMP-16)through enhanced Sp1 and NF-kappa B PMID: 24755270
  11. Matrix metalloproteinase 16 (MMP16) was a downstream target of miR-146b-5p. PMID: 21823013
  12. The overexpression of miR-146b-5p in glioblastoma cell lines led to MMP16 mRNA silencing, MMP2 inactivation, and the inhibition of tumour cell migration and invasion. PMID: 23796692
  13. Data show that MMP16 is regulated by miR-146a in spontaneously differentiated Caco-2 cells. PMID: 22348245
  14. MT3-MMP is a matrix-dependent modifier of the invasive tumor cell functions during melanoma progression PMID: 22164270
  15. Results report the structure of the catalytic domain (cd) of the membrane-type matrix metalloproteinase MT3-MMP/MMP-16 in complex with the hydroxamic acid inhibitor batimastat. PMID: 14741217
  16. MT3-MMP is not only important in matrix degradation but also may affect the function of focal adhesions through FAK cleavage. PMID: 15044209
  17. Type-3 metalloproteinases, are identified as the triggering agents that independently confer cancer cells with the ability to proteolytically efface the BM scaffolding, initiate the assembly of invasive pseudopodia, and propagate transmigration. PMID: 16983145
  18. Chondroitin-4-sulfate, which is expressed on tumour cell surface, can function to bind to pro-MMP-2 and facilitate its activation by MT3-MMP-expressing tumour cells to enhance invasion and metastasis PMID: 17217338
  19. We have demonstrated the expression of MT3-MMP in hepatocellular carcinoma tissues (HCC) and that the expression in HCC significantly correlates with capsular invasion. PMID: 17419254
  20. MMP16 polymorphisms appear to influence not only the pulmonary expression and function of MMP16 but also the risk of bronchopulmonary dysplasia PMID: 18784838
  21. miR-146b is involved in glioma cell migration and invasion by targeting MMP16; implicating miR-146b as a metastasis-inhibiting miRNA in glioma PMID: 19265686

Show More

Hide All

Subcellular Location
[Isoform Long]: Cell membrane; Single-pass type I membrane protein; Extracellular side. Note=Localized at the cell surface of melanoma cells.; [Isoform Short]: Secreted, extracellular space, extracellular matrix. Cell surface. Note=Localized at the cell surface of melanoma cells.
Protein Families
Peptidase M10A family
Tissue Specificity
Expressed in heart, brain, placenta, ovary and small intestine. Isoform Short is found in the ovary.
Database Links

HGNC: 7162

OMIM: 602262

KEGG: hsa:4325

STRING: 9606.ENSP00000286614

UniGene: Hs.492187

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1