Recombinant Human Membrane progestin receptor alpha(PAQR7)

Code CSB-CF768224HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q86WK9
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRF YFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSF SALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAF LAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLY HKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEAR RPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK
Source in vitro E.coli expression system
Gene Names PAQR7
Protein Names Recommended name: Membrane progestin receptor alpha Short name= mPR alpha Alternative name(s): Progestin and adipoQ receptor family member 7 Progestin and adipoQ receptor family member VII
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Tissue Specificity Expressed in a wide range of tissues including ovary, testis, placenta, uterus and bladder.
Database Links

HGNC: 23146

OMIM: 607779

KEGG: hsa:164091

STRING: 9606.ENSP00000363414

UniGene: Hs.523652

Related Products

PAQR7 Antibodies

PAQR7 Antibodies for Homo sapiens (Human)

PAQR7 Proteins

PAQR7 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.