Recombinant Human Mesoderm-specific transcript homolog protein (MEST)

Code CSB-CF704858HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MEST
Uniprot No.
Alternative Names
MEST; PEG1; Mesoderm-specific transcript homolog protein; Paternally-expressed gene 1 protein
Species
Homo sapiens (Human)
Expression Region
1-335
Target Protein Sequence
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. We conclude methylation changes at some CpG sites of MEST and DLK differentially methylated regions in preeclamptic group PMID: 29157033
  2. Some growth-regulating imprinted genes such as MEST and MEG3, are susceptible to non-imprinted allele during development and differentiation, whereas the intergenic differentially methylated region of others (i.e. PEG3) are strictly maintained. PMID: 28854270
  3. strongly expressed in invasive extravillous trophoblasts during the first trimester PMID: 27697227
  4. G4 formation at motifs not previously identified through bioinformatic analysis of the MEST promoter, is reported. PMID: 28052120
  5. altered DNA methylation at imprinted domains including IGF2/H19 and PEG1/MEST may mediate the association between human papillomavirus infection and invasive cervical cancer PMID: 23775149
  6. The expression levels of miR-335 significantly correlated with those of MEST, supporting the notion that the intronic miR-335 is co-expressed with its host gene PMID: 23229728
  7. DNA methylation level at the H19 and MEST differentially methylated regions (DMRs)is reduced in placentas from pregnancies conceived by IVF/ICSI when compared with placentas from spontaneous conception. PMID: 23343754
  8. Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages. PMID: 23415968
  9. These results support the idea that intrauterine exposure to gestational diabetes mellitus has long-lasting effects on the epigenome of the offspring. PMID: 23209187
  10. MEST showed tissue-specific imprinting, being paternally expressed in skeletal muscle, fat, pituitary gland, heart, kidney, lung, stomach and uterus, and maternally expressed in spleen and liver. PMID: 22531794
  11. In cortices, the MEST promoter was hemimethylated, as expected for a differentially methylated imprinting control region, whereas the COPG2 and TSGA14 promoters were completely demethylated, typical for transcriptionally active non-imprinted genes. PMID: 22456293
  12. Regardless of conception method, the PEG1 methylation percentage in chorionic villus from spontaneous abortions is significantly higher than in villus from induced abortions and multifetal reduction. PMID: 21575949
  13. data demonstrated that tumorigenesis of leiomyoma is associated with overexpression of isoform 1 of PEG1/MEST gene, but not with loss of imprinting of the gene PMID: 20339302
  14. MEST gene is imprinted in an isoform-specific manner in adult lymphocytes. PMID: 10631159
  15. MEST gene is imprinted, with preferential expression from the paternal allele in fetal tissues. PMID: 9192843
  16. Findings suggest that PEG1/MEST can be excluded as a major determinant of Silver-Russell syndrome. PMID: 11754049
  17. An imprinted PEG1/MEST antisense expressed predominantly in human testis and in mature spermatozoa. PMID: 11821432
  18. Mutation screening and imprinting analysis of candidate genes for autism in the 7q32 region PMID: 11920156
  19. a novel mechanism /promoter switch/ leading to biallelic expression in invasive breast cancer PMID: 12023987
  20. An intron contains a sequence, MESTIT1, which is transcribed only from the paternal allele, may be involved in MEST regulation PMID: 12095916
  21. Lof imprinting of PEG1/MESTOI may be related to tumorigenesis and malignant transformation, especially in NSCLC PMID: 15547750
  22. PEG1 isoform 2 is in fact imprinted in a large subset of human placentae. PMID: 16338457
  23. Hypermethylation of paternally expressed genes including PEG1/MEST, which have growth-promoting effects, may be relevant to low birth weight in subjects conceived by assisted reproduction techniques. PMID: 17450433
  24. Type of epimutation at the PEG1/MEST locus does not play a relevant role in Silver-Russell syndrome. PMID: 18585117
  25. MEST is localized to the endoplasmic reticulum/Golgi apparatus where its putative enzymatic properties as a lipase or acyltransferase, predicted from sequence homology with members of the alpha/beta fold hydrolase superfamily. PMID: 18644838

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
AB hydrolase superfamily
Tissue Specificity
Highly expressed in hydatidiform moles, but barely expressed in dermoid cysts. Biallelic expression is detected in blood lymphocytes. Seems to imprinted in an isoform-specific manner rather than in a tissue-specific manner in lymphocytes. Isoform 1 is exp
Database Links

HGNC: 7028

OMIM: 601029

KEGG: hsa:4232

STRING: 9606.ENSP00000223215

UniGene: Hs.270978

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×