Recombinant Human Mesoderm-specific transcript homolog protein(MEST)

Code CSB-CF704858HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5EB52
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSI FEQASIVEALLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Source in vitro E.coli expression system
Gene Names MEST
Protein Names Recommended name: Mesoderm-specific transcript homolog protein EC= 3.-.-.- Alternative name(s): Paternally-expressed gene 1 protein
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families AB hydrolase superfamily
Tissue Specificity Highly expressed in hydatidiform moles, but barely expressed in dermoid cysts. Biallelic expression is detected in blood lymphocytes. Seems to imprinted in an isoform-specific manner rather than in a tissue-specific manner in lymphocytes. Isoform 1 is exp
Database Links

HGNC: 7028

OMIM: 601029

KEGG: hsa:4232

STRING: 9606.ENSP00000223215

UniGene: Hs.270978

Related Products

MEST Antibodies

MEST Antibodies for Homo sapiens (Human)

MEST Antibodies for Human

MEST Proteins

MEST Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.