Recombinant Human N-arachidonyl glycine receptor (GPR18)

Code CSB-CF614525HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GPR18
Uniprot No.
Alternative Names
GPR18; GPCRW; N-arachidonyl glycine receptor; NAGly receptor; G-protein coupled receptor 18
Species
Homo sapiens (Human)
Expression Region
1-331
Target Protein Sequence
MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIY MMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRY MAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIY LKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQ VLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISV MLYRNYLRSMRRKSFRSGSLRSLSNINSEML
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for endocannabinoid N-arachidonyl glycine (NAGly). However, conflicting results about the role of NAGly as an agonist are reported. Can also be activated by plant-derived and synthetic cannabinoid agonists. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. May contribute to regulation of the immune system. Is required for normal homeostasis of CD8+ subsets of intraepithelial lymphocytes (IELs) (CD8alphaalpha and CD8alphabeta IELs)in small intstine by supporting preferential migration of CD8alphaalpha T-cells to intraepithelial compartment over lamina propria compartment, and by mediating their reconstitution into small intestine after bone marrow transplant. Plays a role in hypotensive responses, mediating reduction in intraocular and blood pressure. Mediates NAGly-induced process of reorganization of actin filaments and induction of acrosomal exocytosis.
Gene References into Functions
  1. Results indicate that G protein-coupled receptor 18 (GPR18) might be involved in physiological processes of spermatozoa, suggesting GPR18 to be a potential player in sperm physiology. PMID: 27572937
  2. A novel RvD2-GPR18 resolution axis stimulates human and mouse phagocyte functions to control bacterial infections and promote organ protection. PMID: 26195725
  3. the results presented herein provide further evidence for GPR18 as a candidate cannabinoid receptor PMID: 24762058
  4. GPR18, the most abundantly overexpressed orphan G-protein-coupled receptor in all melanoma metastases, is constitutively active and inhibits apoptosis, indicating an important role for GPR18 in tumor cell survival. PMID: 20880198
  5. N-arachidonylglycine is a natural ligand for GPR18 PMID: 16844083

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in midpiece of spermatozoon (at protein level). Most abundant in testis and spleen. Highly expressed in CD4 and CD8-positive T-cells as well as CD19-positive B-cells.
Database Links

HGNC: 4472

OMIM: 602042

KEGG: hsa:2841

STRING: 9606.ENSP00000343428

UniGene: Hs.741589

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1