Recombinant Human NKG2-F type II integral membrane protein(KLRC4)

Code CSB-CF012469HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O43908
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
Source in vitro E.coli expression system
Gene Names KLRC4
Protein Names Recommended name: NKG2-F type II integral membrane protein Alternative name(s): NK cell receptor F NKG2-F-activating NK receptor
Expression Region 1-158
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Subcellular Location Membrane, Single-pass type II membrane protein
Tissue Specificity Natural killer cells.
Database Links

HGNC: 6377

OMIM: 602893

KEGG: hsa:8302

STRING: 9606.ENSP00000310216

UniGene: Hs.721094

Pathway Antigen processing and presentation

Related Products

KLRC4 Proteins

KLRC4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.