Recombinant Human ORM1-like protein 3 (ORMDL3)

Code CSB-CF854016HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ORMDL3
Uniprot No.
Alternative Names
ORMDL3; ORM1-like protein 3
Species
Homo sapiens (Human)
Expression Region
1-153
Target Protein Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.
Gene References into Functions
  1. ORMDL3 inhibits the generation of sphingolipids including ceramide and S1P PMID: 27826095
  2. These associations with ORMDL3 are cell type specific, with the most significant 17q21 genotype effects on ORMDL3 expression and HSPA5 induction evident in B cells. Together, these findings have implications for how the interaction of increased ORMDL3 and rhinovirus may predispose to asthma. PMID: 28192616
  3. IRF-3 is an important regulator of ORMDL3 induction following RSV infection by binding directly to the promoter of ORMDL3 PMID: 28336364
  4. MiR-665 induced apoptosis by inhibiting XBP1 and ORMDL3. PMID: 28333149
  5. These studies suggest that increased levels of ORMDL3 contribute to antiviral defense to rhinovirus infection in mice (hORMDL3(zp3-Cre) mice which have universal increased expression of human ORMDL3) through pathways that may include IFNs (IFN-alpha, IFN-beta, IFN-lambda), OAS, and RNAse L. PMID: 28827284
  6. this study demonstrated the upregulation of ORMDL3 in patients with systemic lupus erythematosus PMID: 28747345
  7. ORMDL3 might influence de novo sphingolipid metabolism downstream of serine palmitoyltransferase PMID: 27645259
  8. modest changes (8-13%) in promoter methylation levels of ZPBP2 and GSDMA may cause substantial changes in RNA levels and allelic expression of ZPBP2 and ORMDL3 is mediated by DNA methylation PMID: 28241063
  9. Decreased ORMDL3 expression increased levels of free sphingoid bases and sphingoid base phosphates, and also caused increases in cellular levels of ceramides. PMID: 27313060
  10. ORMDL3 overexpression is associated with asthma. PMID: 27784618
  11. The TT homozygote and the T allele of rs7216389 in ORMDL3 increased bronchiolitis risk. The rs7216389 polymorphism may be a predictor for identifying infants with predisposition to virus-induced wheezing to persistent asthma. PMID: 26782568
  12. Two single nucleotide polymorphisms regulating ORMDL3 expression (rs7216389 and rs9303277) significantly associated with atherosclerosis risk and the evidence of increased ORMDL3 expression in AS cases compared to controls. PMID: 26603569
  13. The SNP (rs7216389) of ORMDL3 does not influence the expression of OPN and TGF-beta1, suggesting that it may not be associated with airway remodeling. PMID: 27097577
  14. ORMDL3 variants have been shown to be associated with Asthma in children with Rhinovirus infections -induced wheezing illnesses. PMID: 26270739
  15. The meta-analysis indicates that ORMDL3 rs7216389 may contribute to increasing susceptibility to asthma. (Meta-analysis) PMID: 26125920
  16. genetic polymorphisms are associated with childhood asthma, and with changes in TH2 cytokines levels PMID: 25930191
  17. the contribution of ORMDL3 to asthma risk may involve changes in sphingolipid metabolism PMID: 25691431
  18. results show that Cbl-b suppresses human ORMDL3 expression through STAT6 PMID: 26112603
  19. Pro-inflammatory gene ORMDL3 SNP rs12603332 may be associated with high LysoPC and apoB levels, which leads to the occurrence of childhood asthma. PMID: 25815492
  20. Studies indicate that genetic variation of the ORMDL3 rs7216389 polymorphism may be a major independent predisposing factor for asthma in ethnically diverse populations. PMID: 25167772
  21. The ORMDL3 locus on chromosome 17q21 is a risk factor for childhood-onset asthma in the Northeastern Han Chinese population. PMID: 24649901
  22. All-trans retinoic acid modulates ORMDL3 expression via transcriptional regulation. PMID: 24204796
  23. results suggest that rs2872507 is associated with ORMDL3 gene expression and with inhaled corticosteroid treatment response in children with atopic asthma. PMID: 22986918
  24. Genetic variants of ORMDL3 on chromosome 17q21 are associated with ankylosing spondylitis susceptibility and severity in a Chinese Han population. PMID: 24219690
  25. signaling pathway cAMP/PKA/CREB plays an important role in regulating ORMDL3 expression PMID: 23577138
  26. The ORMDL3 gene influences childhood asthma and that the TT genotype of the rs7216389 polymorphism is associated with childhood asthma in the Chinese population. PMID: 23096927
  27. A polymorphism in ORMDL3 is associated not only with asthma without rhinitis but also with chronic obstructive pulmonary disease. PMID: 23964555
  28. We have shown that ORMDL3 expression levels modify T-cell calcium signaling and lymphocyte activation. PMID: 23100328
  29. STAT6 plays important roles in regulating the expression of human ORMDL3 by directly binding to the promoter region. PMID: 23461825
  30. ORMDL3 genetic variants in the 17q21 asthma susceptibility locus are significantly associated with AR in the Japanese population. PMID: 23157251
  31. Data show that transfection of ORMDL3 in bronchial epithelial cells induced expression of MMP-9, ADAM-8, CCL-20, IL-8, CXCL-10, CXCL-11, oligoadenylate synthetases (OAS) genes, and selectively activated activating transcription factor 6 (ATF6). PMID: 23011799
  32. allele-specific transcriptional regulation of genes in the asthma-associated chromosomal region 17q12-q21; rs4795397 influences activity of ZPBP2 promoter in an allele-dependent fashion; methylation of exon 1 of ZPBP2 masks the genetic effect on ZPBP2 promoter; ORMDL3 promoter is unmethylated PMID: 22271045
  33. Several polymorphisms in ORMDL3, including rs7216389, rs4378650, rs8076131 and rs4795405, have been associated with childhood asthma risk. PMID: 22017802
  34. This study reveals the presence of a novel ORMDL3 splicing isoform, ORMDL3 V1 in human. PMID: 22015541
  35. The TTAA haplotype of the ORMDL3 gene is marginally associated with asthma in the adult Czech population, and TCAG haplotype is significantly associated with asthma in males. PMID: 21843571
  36. Results suggest an association of 17q21 polymorphisms with ORMDL3, GSDMA expression, and IL-17 secretion early in life. These observations may imply a functional role of the 17q21 locus affecting T-cell development during immune maturation. PMID: 21546069
  37. analysis of whole-genome SNP data in 986 self-reported asthma cases and 1846 controls confirms that variants in ORMDL3 associate with asthma in European and North American populations PMID: 21150878
  38. Data indicat that Association analysis using risk variants for CD led to the identification of a new risk variant associated with AS, ORMDL3. PMID: 21072187
  39. ORMDL3 binds and inhibits SERCA resulting in a reduced ER Ca(2+) concentration and increased unfolded-protein response. PMID: 19819884
  40. results indicate that genetic variants regulating ORMDL3 expression are determinants of susceptibility to childhood asthma PMID: 17611496
  41. a significant association between susceptibility to childhood atopic asthma and the polymorphism regulating ORMDL3 expression in a Japanese population PMID: 18155279
  42. results confirm associations between two SNPs within ORMDL3 and asthma in Mexicans and African Americans, and a trend toward association in Puerto Ricans PMID: 18310477
  43. A common genetic variation at a locus (rs7216389) controlling expression of the ORMDL3 gene increases patient susceptibility to asthma and is associated with poor control of asthma symptoms in children and young adults. PMID: 18395550
  44. ORMDL3 variants associated with asthma susceptibility in North Americans of European ancestry. PMID: 18760456
  45. Childhood asthma and atopy are associated with chromosome 17q21 in Chinese, but such association may involve genes other than ORMDL3 in this region. PMID: 19175592
  46. multiple SNP associations were replicated in both IRAK-3 and ORMDL3, these likely reflect a single disease susceptibility locus in each gene PMID: 19264973

Show More

Hide All

Involvement in disease
Asthma (ASTHMA)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
ORM family
Tissue Specificity
Widely expressed. Expressed in adult and fetal heart, brain, lung, liver, skeletal muscle and kidney. Expressed in adult pancreas and placenta and in fetal spleen abd thymus.
Database Links

HGNC: 16038

OMIM: 600807

KEGG: hsa:94103

STRING: 9606.ENSP00000304858

UniGene: Hs.514151

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1