Recombinant Human Olfactory receptor 10X1(OR10X1)

Code CSB-CF822809HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8NGY0
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCLYLLTLAGNLI IMGLTWVDRSLHTPMYLFLSALSFSETCYTLTIVPKMLEDLLAKDRSISVTGCSLQMCFF LGLGGTNCIILTLMGYDRFLAICNPLRYPLLMTNIVCGQLVASACTAGFFISLTETALIF RDSFCRPNLVKHFFCHMLAVIRLSCIDSNHTEFIITLISVSGLLGTLLLIILTDVFIIST VLRIPSAEGKQKAFTTCASHLTVVIIHFGFASIVYLKPEASGDDTLIAVPYTVITPFLSP IIFSLRNKDMKNAFRRMMGNTVALKK
Source in vitro E.coli expression system
Gene Names OR10X1
Protein Names Recommended name: Olfactory receptor 10X1 Alternative name(s): Olfactory receptor OR1-14
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 14995

KEGG: hsa:128367

STRING: 9606.ENSP00000357132

UniGene: Hs.553589

Related Products

OR10X1 Proteins

OR10X1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.