Recombinant Human Olfactory receptor 51G2(OR51G2)

Code CSB-CF850894HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8NGK0
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MTLGSLGNSSSSVSATFLLSGIPGLERMHIWISIPLCFMYLVSIPGNCTILFIIKTERSL HEPMYLFLSMLALIDLGLSLCTLPTVLGIFWVGAREISHDACFAQLFFIHCFSFLESSVL LSMAFDRFVAICHPLHYVSILTNTVIGRIGLVSLGRSVALIFPLPFMLKRFPYCGSPVLS HSYCLHQEVMKLACADMKANSIYGMFVIVSTVGIDSLLILFSYALILRTVLSIASRAERF KALNTCVSHICAVLLFYTPMIGLSVIHRFGKQAPHLVQVVMGFMYLLFPPVMNPIVYSVK TKQIRDRVTHAFCY
Source in vitro E.coli expression system
Gene Names OR51G2
Protein Names Recommended name: Olfactory receptor 51G2 Alternative name(s): Olfactory receptor OR11-28
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 15198

KEGG: hsa:81282

STRING: 9606.ENSP00000322593

UniGene: Hs.542302

Related Products

OR51G2 Antibodies

OR51G2 Antibodies for Homo sapiens (Human)

OR51G2 Proteins

OR51G2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.