Recombinant Human Olfactory receptor 51I1(OR51I1)

Code CSB-CF867140HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9H343
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MLGLNGTPFQPATLQLTGIPGIQTGLTWVALIFCILYMISIVGNLSILTLVFWEPALHQP MYYFLSMLALNDLGVSFSTLPTVISTFCFNYNHVAFNACLVQMFFIHTFSFMESGILLAM SLDRFVAICYPLRYVTVLTHNRILAMGLGILTKSFTTLFPFPFVVKRLPFCKGNVLHHSY CLHPDLMKVACGDIHVNNIYGLLVIIFTYGMDSTFILLSYALILRAMLVIISQEQRLKAL NTCMSHICAVLAFYVPIIAVSMIHRFWKSAPPVVHVMMSNVYLFVPPMLNPIIYSVKTKE IRKGILKFFHKSQA
Source in vitro E.coli expression system
Gene Names OR51I1
Protein Names Recommended name: Olfactory receptor 51I1 Alternative name(s): Odorant receptor HOR5'beta11 Olfactory receptor OR11-39
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 15200

KEGG: hsa:390063

STRING: 9606.ENSP00000369559

UniGene: Hs.553732

Related Products

OR51I1 Antibodies

OR51I1 Antibodies for Homo sapiens (Human)

OR51I1 Proteins

OR51I1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.