Recombinant Human Olfactory receptor 5F1(OR5F1)

Code CSB-CF016940HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O95221
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MTRKNYTSLTEFVLLGLADTLELQIILFLFFLVIYTLTVLGNLGMILLIRIDSQLHTPMY FFLANLSFVDVCNSTTITPKMLADLLSEKKTISFAGCFLQMYFFISLATTECILFGLMAY DRYAAICRPLLYSLIMSRTVYLKMAAGAFAAGLLNFMVNTSHVSSLSFCDSNVIHHFFCD SPPLFKLSCSDTILKESISSILAGVNIVGTLLVILSSYSYVLFSIFSMHSGEGRHRAFST CASHLTAIILFYATCIYTYLRPSSSYSLNQDKVASVFYTVVIPMLNPLIYSLRSKEVKKA LANVISRKRTSSFL
Source in vitro E.coli expression system
Gene Names OR5F1
Protein Names Recommended name: Olfactory receptor 5F1 Alternative name(s): Olfactory receptor 11-10 Short name= OR11-10 Olfactory receptor OR11-167
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 8343

OMIM: 608492

KEGG: hsa:338674

STRING: 9606.ENSP00000278409

UniGene: Hs.553702

Related Products

OR5F1 Antibodies

OR5F1 Antibodies for Homo sapiens (Human)

OR5F1 Proteins

OR5F1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.