Research Area
            Neuroscience
           
                              
            Alternative Names
            
              OR5V1; Olfactory receptor 5V1; Hs6M1-21; Olfactory receptor OR6-26
             
           
                                        
            Species
            Homo sapiens (Human)
           
                              
                              
            Expression Region
            1-321aa
           
                              
            Target Protein
              Sequence            
            MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY
              Note: The complete
                sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
                translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
                
If the exact amino acid sequence of this recombinant protein is critical to your application,
                please explicitly request the full and complete sequence of this protein before ordering.
                          
           
                                                            
            Tag Info
            
                                          C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
                          
           
                              
            Form
            
                            Lyophilized powder                                          
              Note: We will default ship it in lyophilized form with
                normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry
                ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
              
                          
           
                    
            Buffer
                          Lyophilized from PBS, 6% Trehalose, pH 7.4                          
           
                                                  
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
            Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.            
           
                    
            Notes
            Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
           
                    
            Datasheet & COA
             Please contact us to get it.