Recombinant Human Olfactory receptor 6A2(OR6A2)

Code CSB-CF016993HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O95222
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAIRNHSTLHKPM YFFLANMSFLEIWYVTVTIPKMLAGFVGSKQDHGQLISFEGCMTQLYFFLGLGCTECVLL AVMAYDRYMAICYPLHYPVIVSGRLCVQMAAGSWAGGFGISMVKVFLISGLSYCGPNIIN HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRY KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ EVKRALCCTLHLYQHQDPDPKKASRNV
Source in vitro E.coli expression system
Gene Names OR6A2
Protein Names Recommended name: Olfactory receptor 6A2 Alternative name(s): Olfactory receptor 11-55 Short name= OR11-55 Olfactory receptor 6A1 Olfactory receptor OR11-83 hP2 olfactory receptor
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 15301

OMIM: 608495

KEGG: hsa:8590

STRING: 9606.ENSP00000330384

UniGene: Hs.652252

Related Products

OR6A2 Proteins

OR6A2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.