Recombinant Human Olfactory receptor 9Q2(OR9Q2)

Code CSB-CF847719HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8NGE9
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMY FFLSHLSLVDICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAY DRYTAVCQPLLYVTIITEKARWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCD LPPLLKLSCGDSYTQEVVIIVFALFVMPACILVILVSYLFIIVAILQIHSAGGRAKTFST CASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTVVTPMLNPLIYSLRNKEVKEA TRKALSKSKPARRP
Source in vitro E.coli expression system
Gene Names OR9Q2
Protein Names Recommended name: Olfactory receptor 9Q2
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 15328

KEGG: hsa:219957

STRING: 9606.ENSP00000308714

UniGene: Hs.553643

Related Products

OR9Q2 Antibodies

OR9Q2 Antibodies for Homo sapiens (Human)

OR9Q2 Proteins

OR9Q2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.