Recombinant Human Outer dense fiber protein 4(ODF4)

Code CSB-CF644805HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2M2E3
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT PITQEGVLDPEQKDTHV
Source in vitro E.coli expression system
Gene Names ODF4
Protein Names Recommended name: Outer dense fiber protein 4 Alternative name(s): Outer dense fiber of sperm tails protein 4 Testis-specific protein oppo 1 Short name= hOPPO1
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.
Subcellular Location Membrane, Multi-pass membrane protein
Tissue Specificity Expressed in testis and sperm; especially localized to sperm tail (at protein level).
Database Links

HGNC: 19056

OMIM: 610097

KEGG: hsa:146852

STRING: 9606.ENSP00000331086

UniGene: Hs.186045

Related Products

ODF4 Proteins

ODF4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.