Recombinant Human Ovarian cancer G-protein coupled receptor 1(GPR68)

Code CSB-CF623012HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names GPR68
Uniprot No. Q15743
Alternative Names GPR68; OGR1; Ovarian cancer G-protein coupled receptor 1; OGR-1; G-protein coupled receptor 68; GPR12A; Sphingosylphosphorylcholine receptor
Species Homo sapiens (Human)
Expression Region 1-365
Target Protein Sequence MGNITADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYL CNLTVADLFYICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRY LAVAHPFRFHQFRTLKAAVGVSVVIWAKELLTSIYFLMHEEVIEDENQHRVCFEHYPIQA WQRAINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLAC FLPYHVLLLVRSVWEASCDFAKGVFNAYHFSLLLTSFNCVADPVLYCFVSETTHRDLARL RGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFP TGRLA
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Proton-sensing receptor involved in pH homeostasis. May represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. Mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca(2+) mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Also functions as a metastasis suppressor gene in prostate cancer.
Gene References into Functions
  1. High GPR68 expression is associated with pancreatic ductal adenocarcinoma. PMID: 29092903
  2. different benzodiazepines exhibit a range of biases for OGR1, with sulazepam selectively activating the canonical Gs of the G protein signaling pathway, in heterologous expression systems, as well as in several primary cell types. PMID: 29042451
  3. Our results suggest that OGR1-dependent increases in TRPC4 expression may favour formation of highly Ca(2+) -permeable TRPC4-containing channels that promote transformed granule cell migration. Increased motility of cancer cells is a prerequisite for cancer invasion and metastasis, and our findings may point towards a key role for TRPC4 in progression of certain types of medullablastoma. PMID: 28627017
  4. Blocking of GPR68 or NF-small ka, CyrillicB activity severely attenuated acidification induced IL-8 production. PMID: 27166427
  5. These results suggest that zOGR1, but not GPR4, is also a metal-sensing G-protein-coupled receptor in addition to a proton-sensing G-protein-coupled receptor, although not all metals that activate hOGR1 activated zOGR1. PMID: 28270026
  6. data identify a role for GPR68 as a proton sensor that is required for proper enamel formation PMID: 27693231
  7. coexpression of OGR1- and G2A-enhanced proton sensitivity and proton-induced calcium signals. This alteration is attributed to oligomerization of OGR1 and G2A. The oligomeric potential locates receptors at a specific site, which leads to enhanced PMID: 27049592
  8. Proton-sensing GPCR-YAP Signalling Promotes Cancer-associated Fibroblast Activation of Mesenchymal Stem Cells PMID: 27019624
  9. The deconstruction of OGR1-dependent signaling may aid our understanding of mucosal inflammation mechanisms PMID: 26206859
  10. Provide evidence for the roles of OGR1 and ASIC1a in the regulation of intestinal passive Mg(2+) absorption. PMID: 24375028
  11. the expression of OGR1 in myeloid-derived cells, especially in double positive cells, was required for prostate tumor cell-induced immunosuppression. PMID: 23222714
  12. The involvement of ovarian cancer G-protein-coupled receptor 1 in acidic extracellular environment may be an underlying mechanism responsible for bone pain in osteoporosis or bone metastasis without clinically proved fractures. PMID: 22835475
  13. OGR1 activation increased intracellular calcium in transfected HEK293 cells. PMID: 22508039
  14. It indicated that OGR1 may be a tumor suppressor gene for ovarian cancer. PMID: 21740742
  15. extracellular acidification induces CTGF production through the OGR1/G(q/11) protein and inositol-1,4,5-trisphosphate-induced Ca(2+) mobilization in human airway smooth muscle cells. PMID: 21907704
  16. acidic pH-induced vascular actions of aortic smooth muscle cells can be dissected to OGR1-dependent and -independent pathways: COX-2 expression, PGI(2) production, and MKP-1 expression are mediated by OGR1, but PAI-1 expression is not. PMID: 20622109
  17. ovarian cancer G-protein-coupled receptor 1 (OGR1), previously described as a receptor for sphingosylphosphorylcholine, acts as a proton-sensing receptor stimulating inositol phosphate formation PMID: 12955148
  18. OGR1 was found to evoke strong pH-dependent responses as measured by inositol phosphate accumulation. PMID: 15665078
  19. cAMP accumulation may occur through OGR1-mediated stimulation of the phospholipase C/cyclooxygenase/PGI(2) pathway PMID: 16087674
  20. OGR1 is a novel metastasis suppressor gene for prostate cancer. OGR1's constitutive activity via G alpha(i) contributes to its inhibitory effect on cell migration in vitro. PMID: 17728215
  21. OGR1/G(q/11)/phospholipase C/protein kinase C pathway regulates osteoblastic COX-2 induction and subsequent PGE(2) production in response to acidic circumstances PMID: 18302504

Show More

Hide All

Involvement in disease Amelogenesis imperfecta, hypomaturation type, 2A6 (AI2A6)
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Found at low level in a wide range of tissues, but significantly expressed in lung, kidney, bone and nervous system.
Database Links

HGNC: 4519

OMIM: 601404

KEGG: hsa:8111

STRING: 9606.ENSP00000434045

UniGene: Hs.8882

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1