Recombinant Human P2Y purinoceptor 14(P2RY14)

Code CSB-CF624023HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q15391
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Source in vitro E.coli expression system
Gene Names P2RY14
Protein Names Recommended name: P2Y purinoceptor 14 Short name= P2Y14 Alternative name(s): G-protein coupled receptor 105 UDP-glucose receptor
Expression Region 1-338
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highest expression in the placenta, adipose tissue, stomach and intestine, intermediate levels in the brain, spleen, lung and heart, lowest levels in the kidney.
Database Links

HGNC: 16442

OMIM: 610116

KEGG: hsa:9934

STRING: 9606.ENSP00000308361

UniGene: Hs.2465

Related Products

P2RY14 Antibodies

P2RY14 Antibodies for Homo sapiens (Human)

P2RY14 Antibodies for Human

P2RY14 Proteins

P2RY14 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.