Recombinant Human PDZK1-interacting protein 1 (PDZK1IP1)

Code CSB-CF621650HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PDZK1IP1
Uniprot No.
Alternative Names
PDZK1IP1; MAP17; PDZK1-interacting protein 1; 17 kDa membrane-associated protein; Protein DD96
Species
Homo sapiens (Human)
Expression Region
1-114
Target Protein Sequence
MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPE PAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play an important role in tumor biology.
Gene References into Functions
  1. Our results indicate a potential prognostic role for MAP17 in lung tumours, with particular relevance in lung adenocarcinomas, and highlight the predictive pot0065ntial of this membrane-associated protein for platinum-based therapy and EGFR inhibitor efficacy. Furthermore, we propose bortezomib treatment as a novel and efficacious therapy for lung adenocarcinomas exhibiting high MAP17 expression. PMID: 30119639
  2. MAP17 overexpression activates Notch pathway by sequestering NUMB. High levels of MAP17 correlated with tumorsphere formation and Notch and Stem gene transcription. Its direct modification causes direct alteration of tumorsphere number and Notch and Stem pathway transcription PMID: 28153862
  3. We found that the levels of MAP17 were related to clinical features and poor survival in a cohort of 69 patients with different sarcoma types and suggest that MAP17 is a new biomarker to predict the efficacy of bortezomib as a new therapy for sarcomas. PMID: 27563810
  4. SGLT2/MAP17 functions as a low-affinity Na(+)-glucose cotransporter in the kidney. PMID: 28592437
  5. Differential gene expression analysis demonstrated significant upregulation of PDZK1IP1, EEF1A2 and RPL41 (ENSG00000279483) genes in the intrahepatic cholangiocarcinoma samples when compared with the matched paratumor samples. PMID: 27082702
  6. Data show that bortezomib induces a prosurvival response through cytoprotective autophagy and nuclear factor kappa B (NFkappaB) nuclear translocation, which is repressed by high levels of membrane-associated protein 17 (MAP17). PMID: 25837675
  7. In this study we found that the levels of MAP17 were related to clinical findings and survival in a cohort of 58 patients with larynx cancer PMID: 25788275
  8. Results suggest that the use of MAP17 and SGLT1 markers may identify patients who are likely to exhibit a better response to treatments that boost oxidative stress in other cancer types. PMID: 23418532
  9. MAP17 is overexpressed in late-stage breast tumors, in which oncogenic activity relies on p38 insensitivity to induce intracellular ROS. PMID: 22266858
  10. The Th cell cytokine-induced up-regulation of MAP17 expression may be linked to the down-regulation of filaggrin in normal epidermal keratinocytes, which may be associated with abnormal epidermal differentiation observed in the dermatological diseases. PMID: 19601982
  11. Large scale genetic screening identifies MAP17 as protein bypassing TNF-alpha-induced growth arrest. PMID: 17230460
  12. Independent activation of MAP17 promoter can be driven by oncogenes and might explain the common overexpression of MAP17 in human carcinomas. PMID: 17426052
  13. Tumorigenic capability of MAP17 through a connection between sodium-coupled co-transporters and reactive oxygen species. PMID: 17548903
  14. MAP17 protein activates AKT through ROS and this is determinant to confer resistance to Myc-induced apoptosis in the absence of serum. PMID: 17675338

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed at significant levels only in a single epithelial cell population, the proximal tubular epithelial cells of the kidney. Diffusely expressed in various carcinomas originating from kidney, colon, lung and breast.
Database Links

HGNC: 16887

OMIM: 607178

KEGG: hsa:10158

STRING: 9606.ENSP00000294338

UniGene: Hs.431099

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1