Recombinant Human PQ-loop repeat-containing protein 2(PQLC2)

Code CSB-CF744399HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6ZP29
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLISILCFAASTFPQFIKA YKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLVMLTLYFYYK FRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQ EVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFALVMLGNTLYGLSVLLKNPE EGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTAASELEPLLPS
Source in vitro E.coli expression system
Gene Names PQLC2
Protein Names Recommended name: PQ-loop repeat-containing protein 2
Expression Region 1-291
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Amino acid transporter that specifically mediates the pH-dependent export of the cationic amino acids arginine, histidine and lysine from lysosomes.
Subcellular Location Lysosome membrane, Multi-pass membrane protein
Protein Families Laat-1 family
Database Links

HGNC: 26001

OMIM: 614760

KEGG: hsa:54896

STRING: 9606.ENSP00000364295

UniGene: Hs.647620

Related Products

PQLC2 Antibodies

PQLC2 Antibodies for Homo sapiens (Human)

PQLC2 Proteins

PQLC2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.