Recombinant Human Platelet glycoprotein Ib beta chain(GP1BB)


In Stock
Code CSB-CF009686HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P13224
Lead Time 3-7 business days
Relevance Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Research Area Others
Source in vitro E.coli expression system
Gene Names GP1BB
Protein Names Antigen CD42b-beta CD_antigen: CD42c
Expression Region 26-206aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 39.3 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.
Involvement in disease Bernard-Soulier syndrome (BSS)
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Expressed in heart and brain.
Database Links

HGNC: 4440

OMIM: 138720

KEGG: hsa:2812

STRING: 9606.ENSP00000383382

UniGene: Hs.283743

Pathway Hematopoietic cell lineage

Related Products

GP1BB Antibodies

GP1BB Antibodies for Human

GP1BB Proteins

GP1BB Proteins for Homo sapiens (Human)

GP1BB ELISA Kit

GP1BB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.