Recombinant Human Post-GPI attachment to proteins factor 3(PGAP3)

Code CSB-CF856935HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96FM1
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLY LQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCV AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFR ALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVV LLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEDKFKLD
Source in vitro E.coli expression system
Gene Names PGAP3
Protein Names Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): COS16 homolog Short name= hCOS16 Gene coamplified with ERBB2 protein PER1-like domain-containing protein 1
Expression Region 21-320
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. Required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI (Probable).
Involvement in disease Hyperphosphatasia with mental retardation syndrome 4 (HPMRS4)
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families PGAP3 family
Tissue Specificity Ubiquitously expressed, with highest levels in thyroid and placenta.
Database Links

HGNC: 23719

OMIM: 611801

KEGG: hsa:93210

STRING: 9606.ENSP00000300658

UniGene: Hs.462971

Related Products

PGAP3 Proteins

PGAP3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.