Recombinant Human Potassium channel subfamily K member 10(KCNK10)

Code CSB-CF012063HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names KCNK10
Uniprot No. P57789
Alternative Names KCNK10; TREK2; Potassium channel subfamily K member 10; Outward rectifying potassium channel protein TREK-2; TREK-2 K(+ channel subunit
Species Homo sapiens (Human)
Expression Region 1-538
Target Protein Sequence MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQ GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVS PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYS LDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids.
Gene References into Functions
  1. The M2-glycine hinge controls the macroscopic currents of TREK1 channels. PMID: 28676394
  2. This study showed that KCNK10 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders. PMID: 26381449
  3. The selectivity filter conformations of alternative translation initiation isoforms and wild type human TREK-2 are similar in the S4 site and pHo position. PMID: 26271386
  4. Results suggest that the cytosolic C-terminal domain and the bottom of transmembrane segment M2 are required for the 2-aminoethoxydiphenyl borate activation on TREK-2 channels PMID: 25982558
  5. How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2. PMID: 26332952
  6. Modulation of K2P 2.1 and K2P 10.1 K(+) channel sensitivity to carvedilol by alternative mRNA translation initiation PMID: 25168769
  7. PLD2, but not PLD1, directly binds to the C terminus of TREK1 and TREK2. PMID: 25197053
  8. crystal structures of TREK-2 channel in 2 conformations and in complex with norfluoxetine, a state-dependent blocker of TREK channels; results provide an explanation for TREK channel mechanosensitivity, regulation by diverse stimuli and possible off-target effects of Prozac PMID: 25766236
  9. High TREK-2 expression is associated with epithelial ovarian cancer. PMID: 23479219
  10. Tissue-specific mRNA splicing regulates alternative translation initiation (ATI) of human K(2P)10.1 K+ background channels via recombination of 5 nucleotide motifs. PMID: 21669980
  11. Expression pattern and functional characteristics of two novel splice variants of the two-pore-domain potassium channel TREK-2. PMID: 11897838
  12. Predicts the role of TREK-2 in brain ischemia, memory and other tissues.[REVIEW] PMID: 17689202

Show More

Hide All

Subcellular Location Membrane; Multi-pass membrane protein.
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Abundantly expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine. Isoform b is strongly expressed in kidney (primarily in the proximal tubule) and pancreas, whereas isoform c is abundantly expressed in brain.
Database Links

HGNC: 6273

OMIM: 605873

KEGG: hsa:54207

STRING: 9606.ENSP00000310568

UniGene: Hs.560255

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1