Recombinant Human Potassium channel subfamily K member 15(KCNK15)

Code CSB-CF867147HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9H427
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MRRPSVRAAGLVLCTLCYLLVGAAVFDALESEAESGRQRLLVQKRGALRRKFGFSAEDYR ELERLALQAEPHRAGRQWKFPGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPL TLVTFQSLGERLNAVVRRLLLAAKCCLGLRWTCVSTENLVVAGLLACAATLALGAVAFSH FEGWTFFHAYYYCFITLTTIGFGDFVALQSGEALQRKLPYVAFSFLYILLGLTVIGAFLN LVVLRFLVASADWPERAARPPSPRPPGAPESRGLWLPRRPARSVGSASVFCHVHKLERCA RDNLGFSPPSSPGVVRGGQAPRPGARWKSI
Source in vitro E.coli expression system
Gene Names KCNK15
Protein Names Recommended name: Potassium channel subfamily K member 15 Alternative name(s): Acid-sensitive potassium channel protein TASK-5 TWIK-related acid-sensitive K(+) channel 5 Two pore potassium channel KT3.3 Short name= Two pore K(+) cha
Expression Region 1-330
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable potassium channel subunit. No channel activity observed in heterologous systems. May need to associate with another protein to form a functional channel.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Detected in pancreas, heart, placenta, lung, liver, kidney, ovary, testis, skeletal muscle and adrenal gland, and at lower levels in prostate, spleen and thyroid gland.
Database Links

HGNC: 13814

OMIM: 607368

KEGG: hsa:60598

STRING: 9606.ENSP00000361952

UniGene: Hs.528664

Related Products

KCNK15 Antibodies

KCNK15 Antibodies for Homo sapiens (Human)

KCNK15 Proteins

KCNK15 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.