Recombinant Human Potassium channel subfamily K member 18 (KCNK18)

Code CSB-CF801805HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
KCNK18
Uniprot No.
Alternative Names
KCNK18; TRESK; TRIK; Potassium channel subfamily K member 18; TWIK-related individual potassium channel; TWIK-related spinal cord potassium channel
Species
Homo sapiens (Human)
Expression Region
1-384
Target Protein Sequence
MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEK FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKW CPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTL QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQN RLIDIYKNVMLFFAKGKFYHLVKK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. May function as background potassium channel that sets the resting membrane potential. Channel activity is directly activated by calcium signal. Activated by the G(q)-protein coupled receptor pathway. The calcium signal robustly activates the channel via calcineurin, whereas the anchoring of 14-3-3/YWHAH interferes with the return of the current to the resting state after activation. Inhibited also by arachidonic acid and other naturally occurring unsaturated free fatty acids. Channel activity is also enhanced by volatile anesthetics, such as isoflurane. Appears to be the primary target of hydroxy-alpha-sanshool, an ingredient of Schezuan pepper. May be involved in the somatosensory function with special respect to pain sensation.
Gene References into Functions
  1. The presence of SCN1A mutations and absence of mutations in ATP1A2 or CACNA1A suggest that the Polish patients represent FHM type 3. PMID: 26747084
  2. This study reveals new pharmacological modulators of K2P18.1 activity useful in dissecting native K2P18.1 function PMID: 24972239
  3. Our study shows the presence of several KCNK18 gene mutations in both migraine with aura and migraine without aura PMID: 25324165
  4. Migraine-associated TRESK mutation, but not the C110R variant, reduces the endogenous TRESK currents to a degree that affects trigeminal ganglion neuron excitability PMID: 24805079
  5. LQLP site is a fundamental determinant of the calcium-sensitivity of human TRESK. PMID: 25202008
  6. No association was observed for three polymorphisms in the KCNK18 gene with migraine phenotype or with any haplotypes. PMID: 23911303
  7. T cell lymphoblastic leukemias/lymphomas express TRESK protein. PMID: 23541583
  8. dominant-negative mutation of human TRESK was found to be linked to migraine with aura in a large pedigree. It is hoped that future TRESK agonists may prevent or ameliorate the debilitating symptoms of migraine. PMID: 22115960
  9. A frameshift mutation in the two-pore potassium channel protein TRESK is linked to migraine pathogenesis. (Review) PMID: 21855646
  10. a role for TRESK in the pathogenesis of typical migraine with aura. PMID: 20871611
  11. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  12. single residue of TRESK was found to be glycosylated upon heterologous expression. Signals of the N-glycosylation mutants were reduced by >50% because of inadequate surface expression of the channel. PMID: 20006580
  13. TRESK is a novel two-pore domain K+ channel that may set the resting membrane potential of cells in the spinal cord PMID: 12754259
  14. TRESK is activated by increased cytoplasmic calcium concentration, calcineurin being involved in the regulation; Serine 276 was identified as the major functional target of calcineurin in TRESK PMID: 14981085
  15. TRESK-2 is a functional member of the K(2P) channel family and contributes to the background K+ conductance in many types of cells [TRESK-2] PMID: 15123670
  16. Because 14-3-3 proteins are ubiquitous, they are expected to control the duration of calcineurin-mediated TRESK activation in all the cell types that express the channel, depending on the phosphorylation state of serine 264. PMID: 18397886
  17. background K+ currents expressed in Jurkat cells are mediated by TRESK channels PMID: 18506476
  18. Observational study of gene-disease association. (HuGE Navigator) PMID: 16385451

Show More

Hide All

Involvement in disease
Migraine with or without aura 13 (MGR13)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity
Expressed specifically in dorsal root ganglion and trigeminal ganglion neurons. Detected at low levels in spinal cord.
Database Links

HGNC: 19439

OMIM: 613655

KEGG: hsa:338567

STRING: 9606.ENSP00000334650

UniGene: Hs.449650

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1