Recombinant Human Potassium channel subfamily K member 1(KCNK1)

Code CSB-CF012062HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O00180
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Source in vitro E.coli expression system
Gene Names KCNK1
Protein Names Recommended name: Potassium channel subfamily K member 1 Alternative name(s): Inward rectifying potassium channel protein TWIK-1 Potassium channel KCNO1
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues
Subcellular Location Cell membrane, Multi-pass membrane protein, Recycling endosome, Cell junction, synapse, Cytoplasmic vesicle, Perikaryon, Cell projection, dendrite, Cell projection, Apical cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Detected in bronchial epithelial cells (PubMed:21964404). Detected in heart left atrium and left ventricle (PubMed:17478540). Detected in cardiac myocytes (at protein level) (PubMed:21653227). Widely expressed with high levels in heart, brain and kidney,
Database Links

HGNC: 6272

OMIM: 601745

KEGG: hsa:3775

STRING: 9606.ENSP00000355580

UniGene: Hs.208544

Related Products

KCNK1 Antibodies

KCNK1 Antibodies for Homo sapiens (Human)

KCNK1 Antibodies for Human

KCNK1 Proteins

KCNK1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.