Recombinant Human Potassium channel subfamily K member 6(KCNK6)

Code CSB-CF896482HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9Y257
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALD AFVERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK AFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVV VTVCFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV YLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQL SASSHTDYASIPR
Source in vitro E.coli expression system
Gene Names KCNK6
Protein Names Recommended name: Potassium channel subfamily K member 6 Alternative name(s): Inward rectifying potassium channel protein TWIK-2 TWIK-originated similarity sequence
Expression Region 1-313
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Exhibits outward rectification in a physiological K(+) gradient and mild inward rectification in symmetrical K(+) conditions.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Widespread expression, detected in all tissues tested except for skeletal muscle. Strongest expression in placenta, pancreas, heart, colon and spleen, lower levels detected in peripheral blood leukocytes, lung, liver, kidney and thymus. Lowest expression
Database Links

HGNC: 6281

OMIM: 603939

KEGG: hsa:9424

STRING: 9606.ENSP00000263372

UniGene: Hs.240395

Related Products

KCNK6 Antibodies

KCNK6 Antibodies for Homo sapiens (Human)

KCNK6 Proteins

KCNK6 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.