Recombinant Human Potassium channel subfamily K member 6(KCNK6)

Code CSB-CF896482HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names KCNK6
Uniprot No. Q9Y257
Alternative Names D7Ertd764e; FLJ12282; Inward rectifying potassium channel protein TWIK 2; Inward rectifying potassium channel protein TWIK-2; K2p6.1; K2P6.1 potassium channel; KCNK6; KCNK6_HUMAN; KCNK8; Potassium channel subfamily K member 6; Potassium channel, subfamily K, member 6 (TWIK 2); Potassium channel, subfamily K, member 6; TOSS; TWIK 2; TWIK 2 two pore domain K+ channel; TWIK originated sodium similarity sequence; TWIK-originated similarity sequence; TWIK2
Species Homo sapiens (Human)
Expression Region 1-313
Target Protein Sequence MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALD AFVERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK AFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVV VTVCFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV YLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQL SASSHTDYASIPR
Protein Length full length protein
Tag Info The following tags are available.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Exhibits outward rectification in a physiological K(+) gradient and mild inward rectification in symmetrical K(+) conditions.
Gene References into Functions
  1. Identification and characterization of Kcnk6 expression within the mammalian cochlea established the gene as a functional candidate for DFNA4. PMID: 14689445
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Widespread expression, detected in all tissues tested except for skeletal muscle. Strongest expression in placenta, pancreas, heart, colon and spleen, lower levels detected in peripheral blood leukocytes, lung, liver, kidney and thymus. Lowest expression
Database Links

HGNC: 6281

OMIM: 603939

KEGG: hsa:9424

STRING: 9606.ENSP00000263372

UniGene: Hs.240395

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1