Recombinant Human Potassium voltage-gated channel subfamily D member 3 (KCND3)

Code CSB-CF890913HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
KCND3
Uniprot No.
Alternative Names
KCND3; Potassium voltage-gated channel subfamily D member 3; Voltage-gated potassium channel subunit Kv4.3
Species
Homo sapiens (Human)
Expression Region
1-655
Target Protein Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Gene References into Functions
  1. mutations cause a gainoffunction of KV4.3/KChIP2encoded channels by increasing membrane protein expression and slowing channel inactivation. PMID: 26016905
  2. Mefloquine is a concentration-dependent Ito and hKv4.3 channel blocker. PMID: 26216464
  3. Altered Kv4.3 channel localization and/or functioning resulting from SCA19/22 mutations may lead to Purkinje cell loss, neurodegeneration and ataxia. PMID: 25854634
  4. the interaction of DPP10a, expressed in human atrium, with Kv4.3 channels generates a sustained current component of Ito, which may affect late repolarization phase of atrial action potentials. PMID: 25600224
  5. Kv4.3 K(+) channel is involved in heart hypertrophy/heart failure independently of its electric function.[review] PMID: 24762397
  6. Demonstrate SEMA3A as a naturally occurring protein that selectively inhibits Kv4.3 and SEMA3A as a possible Brugada syndrome susceptibility gene through a Kv4.3 gain-of-function mechanism. PMID: 24963029
  7. maps to chromosome 1p21-q21 and identification in Dutch autosomal dominant cerebellar ataxia family PMID: 12384780
  8. These results indicate that Kv4.3 is likely the target of discrepin and highlight the importance of the basic residue K13, located in the alpha-helix of the toxin, for current blockage. PMID: 24845726
  9. findings indicate mutations in KCND3 are not a common cause of disease among rarer types of European cerebellar ataxia; however 2 variants were identified in the SCA cases: p.L450F and p.P614S; mutations in KCND3 can cause 2 allelic disorders, SCA19/22 and Brugada syndrome which may co-occur PMID: 23963749
  10. Report a KV4.3 gain-of-function mutation in early-onset persistent lone atrial fibrillation. PMID: 23400760
  11. expression of the sodium (SCN5A) and potassium (KCND3) channels as well as the fibrosis content in the ventricles of heart failure and of non-diseased hearts under different post-mortem intervals PMID: 23036686
  12. The biophysical characteristics of Kv4.3 channels are strongly dependent on temperature. PMID: 23291429
  13. This study demonistrated that Mutations in KCND3 cause spinocerebellar ataxia type 22 in chinese and japanese. PMID: 23280837
  14. This study demonistrated that KCND3 mutations cause SCA19 by impaired protein maturation and/or reduced channel function PMID: 23280838
  15. KCND3 may serve as a rare genetic substrate in the pathogenesis of autopsy-negative sudden unexplained death (SUD) but not sudden infant death syndrome (SIDS) cases. PMID: 22457051
  16. Human atrial I(to) and cloned hKv4.3 channels are modulated by EGFR kinase via phosphorylation of the Y136 residue and by Src-family kinases via phosphorylation of the Y108 residue. PMID: 22198508
  17. Deep insights into the mechanism of the regulation of Kv4.3 K channels and the role of Kv4.3 K channels in cell death. PMID: 22023388
  18. Kv4.3 macromolecular complex and regulators of KCND3 expression is needed to elucidate the role of the Ito current in the pathogenesis of BrS and other J-wave syndromes. PMID: 21349352
  19. The "structurally minimal" isoform KChIP2d modulates recovery of K(v)4.3 N-terminal deletion mutant Delta2-39. PMID: 21422811
  20. our findings suggest that KChIP1 interacts with Kv4.3 in interneurons at the stratum lacunosum-moleculare/radiatum junction PMID: 21129448
  21. The I(to) activator NS5806 modified Kv4.3/KChIP2 gating in several ways that inhibit current. PMID: 20649599
  22. KChIP4a functions to promote tetrameric assembly and enhance surface expression of Kv4 channels. PMID: 20550899
  23. N-linked glycosylation of DPP10 plays an important role in modulating Kv4.3 channel/KCHIP2 complex activities. PMID: 20354865
  24. Down-regulated atrial KChIP2 and Kv4.3 mRNA expressions in rheumatic heart disease patients with chronic atrial fibrillation might be one of the molecular bases responsible for the down-regulation of the I(to) current density of AF. PMID: 19927631
  25. Kv4.3 promiscuously assembles with ancillary subunits in vitro, functionally modifying the encoded currents. PMID: 12297301
  26. Analysis with chimeric proteins between KChIP2 and NCS-1 reveals that the three regions of KChIP2 are necessary and sufficient for its effective binding to Kv4.3 protein PMID: 12928444
  27. the two arginines in the cytosolic C-terminal domain of alpha-subunits of Kv4 subfamily strongly regulate the voltage dependence of channel activation, inactivation, and recovery PMID: 14645239
  28. Both Kv4.3 and KChIP2 may contribute to epicardial-endocardial gradients in the transient outward current in normal and failing hearts. PMID: 15498806
  29. Co-expression of SGK1, but not of SGK2 or SGK3, increased Kv 4.3/KChIP2b channel currents. PMID: 15578212
  30. Co-expression of DPPX in addition to Kv4.3 and KChIP2a produced similar current kinetics as in human ventricular myocytes PMID: 15890703
  31. KCNE3 also inhibits currents generated by Kv4.3 in complex with the accessory subunit KChIP2 PMID: 16782062
  32. the mechanisms involved in Syn1A-K(v) interactions vary significantly between K(v) channels, thus providing a wide scope for Syn1A modulation of exocytosis and membrane excitability PMID: 17506992
  33. Kv4.3 regulates angiotensin type 1 receptor signaling to the small G-protein Rap-1 PMID: 17725712
  34. KCND3 mutations were not found to directly cause long QT syndrome. PMID: 18052691
  35. c-Src-induced Kv4.3 channel activation involves their association in a macromolecular complex PMID: 18620005
  36. NO and NO donors inhibited I(Kv4.3) in a concentration- and voltage-dependent manner. PMID: 18678642

Show More

Hide All

Involvement in disease
Spinocerebellar ataxia 19 (SCA19); Brugada syndrome 9 (BRGDA9)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell projection, dendrite.
Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.3/KCND3 sub-subfamily
Tissue Specificity
Highly expressed in heart and brain, in particular in cortex, cerebellum, amygdala and caudate nucleus. Detected at lower levels in liver, skeletal muscle, kidney and pancreas. Isoform 1 predominates in most tissues. Isoform 1 and isoform 2 are detected a
Database Links

HGNC: 6239

OMIM: 605411

KEGG: hsa:3752

STRING: 9606.ENSP00000319591

UniGene: Hs.666367

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×