Recombinant Human Potassium voltage-gated channel subfamily E member 1(KCNE1)

Code CSB-CF012025HU
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names KCNE1
Uniprot No. P15382
Alternative Names Delayed rectifier potassium channel subunit IsK; Human cardiac delayed rectifier potassium channel protein; IKs producing slow voltage gated potassium channel subunit beta Mink; IKs producing slow voltage-gated potassium channel subunit beta Mink; ISK; JLNS 2; JLNS; JLNS2; KCNE 1; KCNE1; KCNE1_HUMAN; LQT 5; LQT5; MGC33114; Minimal potassium channel; MinK; Potassium voltage gated channel Isk related family member 1; Potassium voltage gated channel Isk related subfamily member 1 ; Potassium voltage gated channel subfamily E member 1; Potassium voltage-gated channel subfamily E member 1
Species Homo sapiens (Human)
Expression Region 1-129
Target Protein Sequence MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1
Gene References into Functions
  1. S38G mutation induced a loss-of-function of IKs due to decreasing of KCNE1 protein expression and defecting in KCNE1 protein membrane trafficking PMID: 29395134
  2. All the protein systems generated through these processes were refined by long Molecular Dynamics simulations. The refined models were analyzed extensively to infer data about the interaction of KCNQ1 channel with its accessory KCNE1 beta subunits. PMID: 28992529
  3. In lesion samples collected from children with cardiac insufficiency, for Mink-S27, we detected significant difference in AA, CC genotype frequency and allele frequency between the observation group and the control group PMID: 28829496
  4. SUMOylation of KCNQ1 is KCNE1 dependent and determines the native attributes of cardiac IKs in vivo. PMID: 28743749
  5. Equine KV7.1/KCNE1 expressed in CHO-K1 cells exhibited electrophysiological properties that are overall similar to the human orthologs; however, a slower deactivation was found which could result in more open channels at fast rates. PMID: 28917093
  6. The KCNE1 (rs1805127) appears to an independent risk factor for AF in the Uygur population. And the KCNE4 (rs12621643) was an independent risk factor for AF among both Uygurs and Hans. PMID: 28981946
  7. Western blotting analysis combined with these pharmacological data suggest that long-term insulin treatment augments KCNQ1/KCNE1 currents by increasing KCNE1 protein expression. PMID: 28882596
  8. KCNQ1/KCNE1 channel does not require phosphatidylinositol-4,5-bisphosphate (PIP2) or phosphatidylinositol-4-phosphate for anterograde trafficking, but is heavily reliant on PIP2 for channel function once at the plasma membrane. PMID: 29020060
  9. The genetic variant rs426496 in AQP2; rs591810 in AQP3 and rs1805127, rs1805128, and rs17173510, in KCNE1 were found in patients with Meniere's disease PMID: 27509294
  10. Meta-analysis suggests that the G38S polymorphism in the KCNE1 gene can significantly increase the risk of atrial fibrillation in both Chinese and white individuals. PMID: 28640127
  11. Sphingomyelin synthase 1 positively regulates KCNQ1/KCNE1 channel density in a protein kinase D-dependent manner. PMID: 27194473
  12. Receptor Species-dependent Desensitization Controls KCNQ1/KCNE1 K+ Channels as Downstream Effectors of Gq Protein-coupled Receptors.( PMID: 27834678
  13. KCNE1 encodes a modulator of KCNQ1 and KCNH2 channels. Long QT syndrome (LQTS) patients with KCNE1(G38S) had a rate-dependent repolarization abnormality similar to patients with LQT2 and, therefore, may have a potential risk to develop lethal arrhythmias. PMID: 27255646
  14. A stoichiometry of 4:4 between the alpha KCNE1 and the beta KCNQ1-subunits has been established. PMID: 26802629
  15. Based on current evidence from published studies, neither of the two variants from KCNE was significantly associated with the risk of Meniere's disease--{REVIEW} PMID: 26890422
  16. Analysis of QT-RR relationship could also evaluate the latent arrhythmogenicity of KCNE1(G38S). PMID: 26520166
  17. The incidence of AF among the senior Uygur population in Xinjiang territory was correlated with the KCNE1 (G38S) polymorphism, which may be an independent risk factor for Uygur AF patients. PMID: 26662381
  18. The KCNQ1 F279I mutation induces a gain of function of IKs due to an impaired gating modulation of Kv7.1 induced by KCNE1, leading to a shortening of the cardiac action potential PMID: 26168993
  19. This study aimed to assess the associations between polymorphisms on KCNE1, KCNQ1, and KCNH2 with the risk of AF in a Chinese population. PMID: 26066992
  20. KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation PMID: 26410412
  21. Two phenylalanine residues on KCNQ1, Phe232 on S4 (VSD) and Phe279 on S5 (pore domain) to be responsible for the gating modulation by KCNE1. PMID: 24920132
  22. acute application of PUFAs increases Kv7.1/KCNE1 through a probably direct effect, and shows antiarrhythmic efficacy under IKr block. PMID: 25497550
  23. IKs phosphorylation and alpha1-AR regulation via activation of calcium-dependent PKC isoforms (cPKC) may be a key mechanism to control channel voltage-dependent activation and consequently action potential duration (APD) in response to adrenergic-stimulus. PMID: 25479336
  24. KCNE1 distal C-terminus appears essential for the regulation of yotiao-mediated PKA phosphorylation. PMID: 25037568
  25. the KCNE1 112G polymorphism may be a risk factor for AF. KCNE1 112G>A may be useful as a biomarker for predicting the development of AF. PMID: 25366730
  26. Klotho upregulates KCNQ1 and KCNE1 channel activity by enhancing channel protein abundance in the cell membrane. PMID: 24457979
  27. KCNE1-D85N is less stable than the wild-type protein, and is rapidly degraded through the ubiquitin-proteasome system. Verapamil may be of a therapeutic value in LQTS patients via preventing degradation of KCNE1-D85N PMID: 24499369
  28. The resilience of the curvature in the KCNE1 transmembrane domain is likely to be maintained upon binding of protein to the KCNQ1 channel. PMID: 25234231
  29. A significant association between Mink S38G gene polymorphism and AF risk was found. G allele carriers may predispose to AF PMID: 24696659
  30. A590T mutation in KCNQ1 C-terminal helix D decreases KCNE1 channel trafficking and function but not Yotiao interaction. PMID: 24713462
  31. Homozygous inheritance of KCNE1(38S) might cause a mild reduction of the delayed rectifier K(+) currents and might thereby increase an arrhythmogenic potential particularly in the presence of QT prolonging factors. PMID: 24419801
  32. KCNE1 divides the voltage sensor movement in KCNQ1/KCNE1 channels into two steps. PMID: 24769622
  33. The transmembrane domains (TMDs) of KCNE1 and KCNE2 were illustrated to associate with the KCNQ1 channel in different modes. PMID: 24827085
  34. study concluded that the variants in KCNQ1, KCNH2, KCNE1 and KCNE2 genes may be correlated with the occurrence of part of sudden unexplained nocturnal death syndrome cases in southern China PMID: 23890619
  35. This study confirmed the association of the 112G>A polymorphism and postoperative AF in a cohort of patients undergoing cardiac surgery. PMID: 24439990
  36. Subjects with LQT-PM may have longer QTc intervals at rest and at peak exercise and all phases of the recovery period compared to controls. Those with homozygous SNPs (KCNE1 35%) had longer resting QTc intervals when compared to heterozygotes. PMID: 23714088
  37. KCNE1 rs1805127 polymorphism increases the risk of atrial fibrillation. PMID: 23874724
  38. KCNE1 maintained a stable cell surface localization, whereas KCNQ1 exhibited variations in the cytosolic compartment (striations versus vesicles) and the degree of presence on the cell surface of cardiac myocytes PMID: 24142691
  39. KCNE1 single nucleotide polymorphism contributed to tinnitus that developed independently of hearing loss. PMID: 23224734
  40. KCNE1 gene abnormality and mutation is associated with long QT synrome development PMID: 23237912
  41. KCNE1 redirects the targeting-deficient KV7.1-Y51A mutant to the apical membrane of MDCK celsl. PMID: 23324056
  42. unsaturated heteromultimeric (KCNQ1)4(KCNE1)n channels are present as components of IKs and are pharmacologically distinct from KCNE-saturated KCNQ1-KCNE1 channels. PMID: 23650380
  43. KCNE1 and KCNE2, auxiliary subunits of voltage-gated potassium channels, undergo sequential cleavage mediated by either alpha-secretase and presenilin(PS)/gamma-secretase or BACE1 and PS/gamma-secretase in cells. PMID: 23504710
  44. The genetic polymorphism of KCNE1 was associated with increased risk of AF in a Chinese Han population. PMID: 23020083
  45. The KCNE1 G38S might have different impact on AF in different ethnicities. PMID: 23129484
  46. Screening of the genotype disclosed the KCNE1 D85N polymorphism, which is known as one of the typical disease-causing gene variants in long-QT syndrome (LQTS). PMID: 22999324
  47. IKs channels open slowly because KCNE1 accessory subunits slow the movement of S4 voltage sensors in KCNQ1 pore-forming subunits. PMID: 23359697
  48. KCNQ1 channels in both the absence and the presence of KCNE1 undergo sequential gating transitions leading to channel opening even before all VSDs have moved. PMID: 22908235
  49. Early-onset lone atrial fibrillation is associated with mutations in the potassium current channel regulatory subunit KCNE1. PMID: 22471742
  50. The KCNE1 variant rs1805128, resulting in D85N, confers substantially increased risk for drug-induced torsades de pointes. PMID: 22100668
  51. When coexpressed with KCNE1, both mutants deactivate significantly slower than wild-type KCNQ1/KCNE1 channels. PMID: 22250012
  52. Post-translational N-glycosylation of type I transmembrane KCNE1 peptides: implications for membrane protein biogenesis PMID: 21676880
  53. investigation of ability of bilayer to stabilize secondary structures of KCNE1: Key components of the micelle-derived structure of KCNE1 extend to the structure of this protein in lipid bilayers. PMID: 22085289
  54. Under heterozygous conditions, the expression of A341V+KCNQ1+KCNE1 reduced but did not abolish the electrophysiological changes observed in A341V+KCNE1. A dominant negative effect of A341V was also observed PMID: 21854832
  55. Data show that KCNQ4 and KCNE1 isoforms were suppressed in placentas from term preeclamptic women. PMID: 21730298
  56. genetic polymorphism of rs1805127 locus of the KCNE1 gene may increase the risk of atrial fibrillation PMID: 21811988
  57. KCNE1 binds to the outer face of the KCNQ1 channel pore domain, modifies interactions between voltage sensor, S4-S5 linker and the pore domain, leading to structural modifications of the selectivity filter and voltage sensor domain. PMID: 21691061
  58. The KCNE1 promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells. PMID: 20494980
  59. PIP(2) has a role in KCNE1 modulation of I(Ks) channels that may represent a common mechanism of auxiliary subunit modulation of many ion channels PMID: 21576493
  60. The effect of th anti-arrhythmic agent NIP-142 on the which underlies the slow component of the cardiac delayed rectifier potassium channel. PMID: 21212535
  61. study concludes that AMPK is a potent regulator of KCNQ1/KCNE1 PMID: 21231794
  62. KCNE1 D85 polymorphism--a sex-specific modifier in type 1 long QT syndrome and is confined to males. PMID: 21244686
  63. Data suggest an imposed requirement for movements of multiple voltage sensors before KCNQ1/KCNE1 channel opening. PMID: 21149716
  64. both the voltage-dependence and kinetics of gating were found to depend on the relative densities of KCNQ1 and KCNE1, suggesting the heart rhythm may be regulated by the relative expression of the auxiliary subunit PMID: 20962273
  65. While assembly of KCNE1 with KCNQ1 does not require co-translation, functional KCNQ1-KCNE1 channels assemble early in the secretory pathway and reach the plasma membrane via vesicular trafficking. PMID: 20139709
  66. Generate a closed-state model of the KCNQ1-KCNE1 cytoplasmic region where these protein-protein interactions are poised to slow activation gate opening. PMID: 20479109
  67. single nucleotide polymorphism of KCNE1 is associated with heart failure. PMID: 20117060
  68. KCNE1 S38G single nucleotide polymorphism is associated with heart failure genetic predisposition. PMID: 20185111
  69. Data suggest that KCNQ1-KCNE1 complexes interact intermittently with the actin cytoskeleton via the C-terminal region and this interaction may have a functional role. PMID: 19940153
  70. data show that SNPs in KCNE1 and KCNE3 are not associated with Meniere disease in Caucasians PMID: 20034061
  71. None of the SNPs of KCNE1 were associated with atrial fibrillation phenotype. PMID: 16563243
  72. Report KCNQ1 mutations which alter slow potassium current, protein trafficking and interactions with KCNE1 resulting in long QT syndrome type 5. PMID: 19907016
  73. regulation by PKA-dependent phosphorylation requires a macromolecular complex that includes PKA, PP1, and the targeting protein yotiao PMID: 11799244
  74. We report the association between the minK 38G allele and clinical atrial fibrillation. PMID: 12228786
  75. All three members of the SGK family of kinases SGK1-3 and protein kinase B stimulate the slowly activating K(+) channel KCNE1/KCNQ1. The kinases may thus participate in the regulation of KCNE1-dependent transport and excitability. PMID: 12634932
  76. Two MinK subunits are necessary, sufficient, and the norm in I(Ks) voltage-gated potassium channels. PMID: 14527430
  77. ER quality control prevents minK-L51H/KvLQT1 complexes from trafficking to the plasma membrane, resulting in decreased I(Ks). PMID: 14761891
  78. Expression of KCNQ1 and KCNE1 associated with early stages of spermatogenesis and with presence of undifferentiated healthy or neoplastic germ cells. KCNQ1/KCNE1 may be involved in K+ transport, probably during germ-cell development. PMID: 15389592
  79. A a variant upstream of the KCNE1 gene (rs727957, +1.2 ms/allele, P=0.0051)is associated with QT interval length. PMID: 15746444
  80. This suggests that genetic determinants located in KCNQ1, KCNE1, KCNH2 and SCN5A influence QTc length in healthy individuals and may represent risk factors for arrhythmias or cardiac sudden death in patients with cardiovascular diseases. PMID: 16132053
  81. Potassium channel gene variants are associated with inherited long QT syndromes PMID: 16266404
  82. interaction of MiRP2-72 with KCNQ1-338; and MinK-59,58 with KCNQ1-339, 340 PMID: 16308347
  83. The result indicates that 112G/A SNP in the KCNE1 gene and 198T/C SNP in the KCNE3 gene could determine an increased susceptibility to develop MD. PMID: 16374062
  84. did not find any mutations in aldosterone-secreting adenomas PMID: 16610241
  85. These results suggest that KCNE2 can functionally couple to KCNQ1 even in the presence of KCNE1. PMID: 16631607
  86. Polymorphisms within the KCNE1 gene are associated with susceptibility Noise-induced hearing loss. PMID: 16823764
  87. no association between atrial fibrillation and single nucleotide polymorphisms PMID: 17016049
  88. The errant KCNE1 trafficking observed in human embryonic kidney cells may be due, in part, to the presence of endogenous voltage-gated potassium channels in these cells. PMID: 17065152
  89. G38S polymorphism in the MinK gene seems to be associated with incidence of lone AF in the population; GG genotype may relate to increased risk of AF in the study; G38S polymorphism in the MinK gene could be used as a genetic marker of risk of lone AF. PMID: 17165161
  90. We demonstrated that 9.5% of cases diagnosed as SIDS carry functionally significant genetic variants in LQTS genes (KCNQ1, KCNH2, SCN5A, KCNE1, KCNE2, KCNJ2, CAV3). PMID: 17210839
  91. External pH can modify current amplitude and biophysical properties of KCNQ1. KCNE subunits work as molecular switches by modulating the pH sensitivity of human KCNQ1. PMID: 17310097
  92. KCNE1 mutations may be associated with mild LQTS phenotypes, and KCNE1 gene screening is of clinical importance for asymptomatic and mild LQTS patients. PMID: 17341399
  93. In chronic heart failure (CHF), the relative abundance of KCNE1 compared to KCNQ1 genes might contribute to the prolongation of QT interval through reducing the net outward current during the plateau of the action potential. PMID: 17384445
  94. biophysical analysis of MinK in IK channels shows an alpha-helical transmembrane span traversing the channel corpus PMID: 17545244
  95. postrepolarization refractoriness to I(Ks) (coassembly of KCNQ1 and KCNE1 )can promote wavebreak formation and fibrillatory conduction during pacing and sustained reentry and may have important implications in tachyarrhythmias PMID: 17626898
  96. analysis of data from 186 Jervell and Lange-Nielsen syndrome patients; most mutations (90.5%) are on the KCNQ1 gene; mutations on the KCNE1 gene are associated with a more benign course PMID: 17646758
  97. KCNE1's secondary structure includes several alpha-helices and demonstrate that its distal C-terminus is disordered. PMID: 17892302
  98. Results suggest that during biogenesis of channels HERG is more likely to assemble with KCNE1 than KCNE2 due to distinctly different trafficking rates and retention in the cell rather than differences in relative affinity. PMID: 17895974
  99. The components of the cardiac slow rectifier channel are discussed. PMID: 17980676
  100. KCNE peptides differently modulate the voltage sensor in KCNQ1 K(+) channels. PMID: 18079560

Show More

Hide All

Involvement in disease Jervell and Lange-Nielsen syndrome 2 (JLNS2); Long QT syndrome 5 (LQT5)
Subcellular Location Cell membrane, Single-pass type I membrane protein, Apical cell membrane, Membrane raft
Protein Families Potassium channel KCNE family
Tissue Specificity Expressed in lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Expressed in the heart (PubMed:19219384). Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial
Database Links

HGNC: 6240

OMIM: 176261

KEGG: hsa:3753

STRING: 9606.ENSP00000337255

UniGene: Hs.121495

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1