Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF890770HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q9UNW8 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | MCPMLLKNGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRIVLVVVYSAVCTLGVPAN CLTAWLALLQVLQGNVLAVYLLCLALCELLYTGTLPLWVIYIRNQHRWTLGLLACKVTAY IFFCNIYVSILFLCCISCDRFVAVVYALESRGRRRRRTAILISACIFILVGIVHYPVFQT EDKETCFDMLQMDSRIAGYYYARFTVGFAIPLSIIAFTNHRIFRSIKQSMGLSAAQKAKV KHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMCGLEERLYTASVVFLCLSTVN GVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFS RPVHPPGSPCPAKRLIEESC |
| Source | in vitro E.coli expression system |
| Gene Names | GPR132 |
| Protein Names | Recommended name: Probable G-protein coupled receptor 132 Alternative name(s): G2 accumulation protein |
| Expression Region | 1-380 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | May be a receptor for oxidized free fatty acids derived from linoleic and arachidonic acids such as 9-hydroxyoctadecadienoic acid (9-HODE). Activates a G alpha protein, most likely G alpha(q). May be involved in apoptosis. Functions at the G2/M checkpoint to delay mitosis. May function as a sensor that monitors the oxidative states and mediates appropriate cellular responses such as secretion of paracrine signals and attenuation of proliferation. May mediate ths accumulation of intracellular inositol phosphates at acidic pH through proton-sensing activity. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | Highly expressed in macrophages and hematopoietic tissues rich in lymphocytes, like spleen and thymus. Weakly expressed in heart and lung. In atherosclerotic plaques, expression is observed around the lipid core and at the shoulder region. |
| Database Links |
HGNC: 17482 OMIM: 606167 KEGG: hsa:29933 STRING: 9606.ENSP00000328818 UniGene: Hs.532504 |
GPR132 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA009749GA01HU | GPR132 Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA002598 | GPR132 Antibody | Human,Mouse,Monkey | WB,IF,ELISA |
| CSB-PA009059 | GPR132 Antibody | Human | WB,IHC,IF,ELISA |
GPR132 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP890770HU1 CSB-EP890770HU1 CSB-BP890770HU1 CSB-MP890770HU1 |
Recombinant Human Probable G-protein coupled receptor 132(GPR132),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Receptor-type tyrosine-protein phosphatase zeta(PTPRZ1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Dog Caveolin-1(CAV1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human Tyrosine-protein kinase JAK1(JAK1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Indoleamine 2,3-dioxygenase 1(Ido1)
Express system: Yeast
Species: Mus musculus (Mouse)
