Recombinant Human Probable G-protein coupled receptor 19(GPR19)

Code CSB-CF621884HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q15760
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MVFAHRMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTDLHYVL KPGEVATASIFFGILWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTP FVLLQFTTGRWTLGSATCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKA KKMIAASWVFDAGFVTPVLFFYGSNWDSHCNYFLPSSWEGTAYTVIHFLVGFVIPSVLII LFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLILNLLFLLSWLPFHVAQLWHP HEQDYKKSSLVFTAITWISFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSNAYTI TTSSRMAKKNYVGISEIPSMAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV
Source in vitro E.coli expression system
Gene Names GPR19
Protein Names Recommended name: Probable G-protein coupled receptor 19 Alternative name(s): GPR-NGA
Expression Region 1-415
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Abundant expression in the brain.
Database Links

HGNC: 4473

OMIM: 602927

KEGG: hsa:2842

UniGene: Hs.657862

Related Products

GPR19 Antibodies

GPR19 Antibodies for Homo sapiens (Human)

GPR19 Proteins

GPR19 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.