Recombinant Human Probable G-protein coupled receptor 85(GPR85)

Code CSB-CF009837HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P60893
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS RLPREPYCVI
Source in vitro E.coli expression system
Gene Names GPR85
Protein Names Recommended name: Probable G-protein coupled receptor 85 Alternative name(s): Super conserved receptor expressed in brain 2
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein, Endoplasmic reticulum
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highly expressed in brain and testis. Lower levels in small intestine, placenta and spleen. In brain regions, detected in all regions tested, but somewhat lower levels in the corpus callosum, medulla and spinal cord.
Database Links

HGNC: 4536

OMIM: 605188

KEGG: hsa:54329

STRING: 9606.ENSP00000297146

UniGene: Hs.152009

Related Products

GPR85 Antibodies

GPR85 Antibodies for Homo sapiens (Human)

GPR85 Proteins

GPR85 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.