Recombinant Human Prokineticin receptor 2 (PROKR2)

Code CSB-CF018749HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
PROKR2; GPR73L1; PKR2; Prokineticin receptor 2; PK-R2; G-protein coupled receptor 73-like 1; G-protein coupled receptor I5E; GPR73b; GPRg2
Species
Homo sapiens (Human)
Expression Region
1-384
Target Protein Sequence
MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK SSADLDLRTNGVPTTEEVDCIRLK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prokineticin 2. Exclusively coupled to the G(q) subclass of heteromeric G proteins. Activation leads to mobilization of calcium, stimulation of phosphoinositide turnover and activation of p44/p42 mitogen-activated protein kinase.
Gene References into Functions
  1. EG-VEGF and PROKR2 were highly expressed in colorectal primary lesions compared to positive controls. PROKR1 expression was lower and did not change in tumor specimens. PMID: 29226856
  2. The deletion contained 17 protein coding genes including PROKR2 and BMP2, both of which are expressed during embryological development of the pituitary gland. PROKR2 mutations have been associated with hypopituitarism but a heterozygous deletion of this gene with hypopituitarism is a novel observation. PMID: 28586151
  3. PROKR2 genetic mutation plays a role in the pathogenesis of pituitary stalk interruption syndrome. PMID: 28453858
  4. a significant association between PKR2 rs6053283 polymorphism and Recurrent pregnancy loss (RPL) (P=0.003), whereas no association was observed between PKR1 rs4627609 polymorphism and RPL (P=0.929) in the Chinese Han population. PMID: 26984842
  5. PROKR2 may play a role in susceptibility of pituitary stalk interruption syndrome PMID: 26956854
  6. PROKR2 expression in human fetal ovary remained unchanged throughout gestation. PMID: 26192875
  7. PKR2 protomers form type II dimers involving TMs 4 and 5, with a role for TM5 in modulation of PKR2 function. PMID: 25449422
  8. PK2-induced PKR2 endocytosis is GRK2- and clathrin-dependent, but beta-arrestin-independent. PMID: 24509228
  9. Wild-type PROKR2 activates different G-protein subtypes (Gq, Gs, and Gi/o) and recruits beta-arrestins. The effects of 9 missense mutations on these 2 processes showed that some mutations affected both or only one of them. PMID: 24830383
  10. Single PROKR2 missense allelic variants can either affect both cAMP and IP signaling pathways differently or selectively. PMID: 24276467
  11. Prokineticin (PK)1/PKR2-signalling pathway is involved in the regulation of the functional adequate capillarization in late pregnancy PMID: 23891065
  12. TSHZ1 is a key regulator of mammalian olfactory bulb development and function and controls the expression of PROKR2. PMID: 24487590
  13. V331M variant confers lower risk for recurrent miscarriage PMID: 23687280
  14. An unexpectedly large prevalence of PROKR2 mutations was found in Kallmann syndrome patients from the Maghreb. PMID: 24031091
  15. the distal region of the IL3 region of PROKR2 may differentially influence receptor trafficking and G-protein coupling PMID: 23969157
  16. PROKR2 signaling does not directly affect Sertoli cell function in autosomal recessive Kallmann syndrome. PMID: 23200691
  17. The role of PROKR2 in the etiology of congenital hypopituitarism, septo-optic dysplasia, and Kallmann syndrome is uncertain. PMID: 23386640
  18. An ancient founder missense mutation in PROKR2 impairs human reproduction. PMID: 22773735
  19. The R80C mutant of PROKR2 exerts a dominant negative effect on wild type PROKR2 by interfering with wild type receptor expression. PMID: 22745195
  20. We report PROKR2 variants in congenital hypopituitarism with pituitary stalk interruption, suggesting a potential role of the prokineticin pathway in pituitary development. PMID: 22466334
  21. hCG increases EG-VEGF, PROKR1 and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, demonstrating a new role for hCG in the regulation of EG-VEGF and its receptors PMID: 22138749
  22. genetic association studies in 103 patients from US and UK: Mutations in PROKR2, FGFR1, or FGF8 contributed to 7.8% of patients with combined pituitary hormone deficiency or septo-optic dysplasia. Data suggest genetic overlap with Kallmann syndrome. PMID: 22319038
  23. The results suggest an identical transmembrane-bundle binding site for hPKR1 and hPKR2. PMID: 22132188
  24. positive charges in the second intracellular loop mutations of the PKR2 receptor have roles in G-protein coupling and receptor trafficking PMID: 21454486
  25. ligation of tubal TLR2 and activation of NFkappaB by C. trachomatis leads to increased tubal PROKR2, thereby predisposing the tubal microenvironment to ectopic implantation. PMID: 21224062
  26. one tag SNP of PKR2 (rs6053283) was significantly associated with idiopathic recurrent pregnancy loss. PMID: 20847187
  27. Patients with this genetic form of Kallmann syndrome have been reported to have a possible increased prevalence of obesity and sleep disorders, which may be related to the role of PROKR2 in food intake and circadian rhythms (Review) PMID: 20389090
  28. PROKR2 may play a role in the pathophysiology of methamphetamine dependence in the Japanese population. PMID: 20576534
  29. The functional characteristics of coronary endothelial cells depend on the expression of PKR1 and PKR2 levels and the divergent signaling pathways used by these receptors. PMID: 20023120
  30. molecular cloning, amino acid sequence and expression in several human tissues PMID: 12427552
  31. Two Kallmann syndrome patients presented a heterozygous T-to-G transversion in exon 2 (c.518T>G). PMID: 18723471
  32. In Kallmann syndrome patients, ten different missense mutations have been identified in PROKR2. PMID: 18826963
  33. Results suggest that PROKR2 may play a role in the pathophysiology of mood disorders in the Japanese population. PMID: 19544013

Show More

Hide All

Involvement in disease
Hypogonadotropic hypogonadism 3 with or without anosmia (HH3)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the ileocecum, thyroid gland, pituitary gland, salivary gland, adrenal gland, testis, ovary and brain.
Database Links

HGNC: 15836

OMIM: 244200

KEGG: hsa:128674

STRING: 9606.ENSP00000217270

UniGene: Hs.375029

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1