Recombinant Human Prostaglandin F2-alpha receptor (PTGFR)

Code CSB-CF018979HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PTGFR
Uniprot No.
Alternative Names
PTGFR; Prostaglandin F2-alpha receptor; PGF receptor; PGF2-alpha receptor; Prostanoid FP receptor
Species
Homo sapiens (Human)
Expression Region
1-359
Target Protein Sequence
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum. Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost.
Gene References into Functions
  1. Data, including data from studies using transgenic mice, suggest that signaling via prostaglandin-F2alpha/PTGFR and Camk2g/p38/Foxo1 MAP kinase/calcium pathways are involved in regulation of hepatic gluconeogenesis in both obesity and fasting. (PTGFR = prostaglandin F2alpha receptor; Camk2g = calcium-calmodulin-dependent protein kinase type 2 gamma; p38 = p38 MAP kinase; Foxo1 = forkhead box transcription factor O1) PMID: 29773555
  2. Data suggest that allosteric communication between heterodimeric AT1R and PTGFR is mediated through GNAQ and may also involve proximal phospholipase C but not distal protein kinase C signaling partners; PTGFR activation has negligible effects on AT1R-based conformational biosensors. (AT1R = angiotensin II receptor, type 1; PTGFR = prostaglandin F2alpha receptor; GNAQ = GTP-binding protein G[q] subunit alpha) PMID: 28584054
  3. The genotype frequencies of six SNPs in AFAP1, GMDS and PTGFR genes were conformed to Hardy-Weinberg equilibrium (HWE). PMID: 27862086
  4. these results indicated that the actions of AKR1C3 can produce FP receptor ligands whose activation results in carcinoma cell survival in breast cancer. PMID: 26170067
  5. The results indicated that the rs12731181 G allele of the Prostaglandin F2alpha Receptor Gene was associated with susceptibility to essential hypertension. PMID: 25977569
  6. Influence of PTGS1, PTGFR, and MRP4 genetic variants on intraocular pressure response to latanoprost in Chinese primary open-angle glaucoma patients PMID: 25339146
  7. The SNPs of the PTGFR and MMP-1 genes may determine the latanoprost response in a white European Spanish population. PMID: 25704319
  8. Angiotensin II type I and prostaglandin F2alpha receptors cooperatively modulate signaling in vascular smooth muscle cells PMID: 25512374
  9. An association was found between SNPs of the FP receptor gene and the response to latanoprost in patients with glaucoma or OH. PMID: 24457363
  10. The results of this study suggested that significant novel association signals near the genes PTGFR, and provide supportive evidence for the previously reported association signals near ANK3 and within the 3p21.1 locus. PMID: 22182935
  11. The F-prostaglandin receptor is a novel marker for tumor endothelial cells in renal cell carcinoma. PMID: 23356224
  12. we found no indication for an association between SNPs in the prostaglandin F(2alpha) receptor gene or SLCO2A1 and IOP response to prostaglandin analogs in a population of European descent. PMID: 22060278
  13. These data demonstrate a role for the FP receptor in regulation of the chemokine CCL20, which can mediate proliferation of endometrial adenocarcinoma epithelial cells. PMID: 20816914
  14. Data show a labour-associated decrease in PTGFR-v1 and PTGFR transcript variant 2 mRNA expression in lower segment myometrial samples. PMID: 20519365
  15. Dental pulp cells expressed prostaglandin FP receptors as analysed by RT-PCR, which showed the presence of 396-bp PCR product. Pulp cells also expressed FP receptor protein (64 kD) as analysed by Western blotting. PMID: 20536573
  16. The prostaglandin F(2alpha) can directly regulate endothelial cell network formation but not endothelial cell proliferation. PMID: 20092633
  17. This study investigated the expression of IL-11 and role of prostaglandin F(2alpha)-F-prostanoid receptor (FP receptor) signaling in the modulation of IL-11 expression in endometrial adenocarcinoma cells. PMID: 20008143
  18. our data have elucidated the molecular and cellular mechanism whereby PGF(2alpha) regulates CXCL8 expression via the FP receptor in endometrial adenocarcinomas and have highlighted RCAN1-4 as a negative regulator of CXCL8 expression PMID: 19819266
  19. identification of amino acids contributing to ligand speificity or signal transduction properties of this protein PMID: 12519077
  20. isolation and sequencing of 4106-bp promoter DNA fragment that contains -2436-bp of 5'-flanking sequence; identification of transcription initiation start site PMID: 14746914
  21. PGF(2 alpha)-FP receptor may promote endometrial tumorigenesis via phospholipase C-mediated phosphorylation of EGF receptor and MAPK signaling pathways. PMID: 14764825
  22. prostaglandin F2alpha production is stimulated by withdrawal of ovarian steroids through nuclear factor-kappaB activation via oxygen radicals PMID: 15118249
  23. Alterations in the amino acid sequence of the C-terminal domain of PTGFR and their effects on GTP-binding protein signalling are reported. PMID: 15651980
  24. The regulation of the FP receptor and the stimulation of production of PGF2alpha in melanocytes in response to ultraviolet radiation suggest that PGF2alpha could act as an autocrine factor for melanocyte differentiation. PMID: 15748887
  25. uteroglobin plays important roles in maintaining homeostasis in organs that are vulnerable to inadvertent stimulation of FP-mediated inflammatory response by inhibiting the prostaglandin F2alpha receptor PMID: 16061484
  26. FP receptor activation of Rho signaling by PGF(2alpha) can interfere with nuclear division PMID: 16378246
  27. NFkappaB is involved in both basal and interleukin 1beta-stimulated transcription of the PTGFR gene. PMID: 16855208
  28. level at term may facilitate the decidua contribution to parturition, and its regulation and role should be examined further. PMID: 16911823
  29. rs3753380 and rs3766355, SNPs in the promoter and intron 1 regions of the FP receptor gene, correlate with a response to short-term latanoprost treatment in normal volunteers. PMID: 17467803
  30. role for PGF(2alpha)-FP receptor interaction in modulating FGF2 expression and signaling using an endometrial adenocarcinoma cell line PMID: 17478553
  31. A novel PGF2alpha receptor single nucleotide polymorphism (SNP), IVS -97A>T, is common in the Malaysian patients with glaucoma. PMID: 17582204
  32. Data show that prostag;andins E2 and F2alpha can mobilize inositol 1,4,5-trisphosphate, induce ERK1/2 phosphorylation and induce cyclooxygenase-2 expression via the FP receptor. PMID: 18316157
  33. Bimatoprost lacks effects on the FP receptor but may interact with the FP-altFP receptor heterodimer to induce alterations in second messenger signalling. PMID: 18587449
  34. FPR signalling mechanism(s) regulating MLC-2 phosphorylation likely extend beyond those classically established for G(q/11)-coupled receptors PMID: 18703533
  35. urinary 8-iso-prostaglandin excretion is enhanced in microalbuminuric compared to nonmicroalbuminuric hypertensive patients or controls PMID: 19280705
  36. Expression and functional evidence of the PTGFR mediating contraction in human umbilical vein are reported. PMID: 19289115
  37. Oxytocin, its receptor and the PGF(2alpha) receptor are involved in the regulation of labour through a paracrine mechanism. PMID: 19347709
  38. The rabbit prostaglandin F receptor (FP) couples to the inhibitory G protein, Gi, to inhibit vasopressin action in the cortical collecting duct. PMID: 16096282

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Eye.
Database Links

HGNC: 9600

OMIM: 600563

KEGG: hsa:5737

STRING: 9606.ENSP00000359793

UniGene: Hs.654365

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1